KEGG   Kitasatospora setae: KSE_29440Help
Entry
KSE_29440         CDS       T01648                                 

Gene name
fbiB
Definition
putative F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
ksk  Kitasatospora setae
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:ksk00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3315361..3316674
Genome map
AA seq 437 aa AA seqDB search
MTGGAGPSALSVLPVPGLPEVAAGDDLAALIARAGAFEDGDILVVTSKVVSKAEGRLVRA
DDREAAIDAETVRVVARRGRARIVENRNGLVMAAAGVDASNTAPGTVLLLPVDPDRSARE
LRARLQELTGRRLAVLVTDTFGRPWREGLTDVAIGAAGLPALEDHRGRVDSHGNELRLTV
TATADELAAAADLVKGKATGTPVAVVRGLGHLVTPADGDGARALVRAPGQDMFRLGTSEA
VREAVTLRRTVRAFTDEPVDGDAVRRAVAAAITAPAPHHTTPWRFVLLETAGARTRLLDA
MLAAWQRDLRELDGWSEERIARRTARGEVLRGAPYLVVPCLVADGSHAYPDPRRAAAERE
MFVVAVGAAVQNLLVTLGGEGYGSAWVSSTMFCRDTVREALELPADWDPMGAVAVGRAAE
QPRDRQPRPADDFLTVR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgggggcgccgggccgtcggcgctctcggtgctgccggtccccgggctgcccgag
gtcgcggccggcgacgacctggccgcactgatcgccagggcgggcgcgttcgaggacggc
gacatcctggtggtcacctccaaggtggtctccaaggccgagggccggctggtccgggcg
gacgaccgggaggccgcgatcgacgccgagaccgtccgggtggtcgcccggcgcggccgg
gcccggatcgtcgagaaccgcaacggcctggtgatggccgcggccggcgtcgacgcgtcc
aacaccgcccccgggacggtcctgctgctgccggtcgaccccgaccggtcggcgcgcgaa
ctgcgggcccggctccaggagttgaccgggcgccggctggccgtgctggtcaccgacacc
ttcggccggccctggcgcgagggcctgaccgacgtcgcgatcggcgccgccggactgccc
gcgctggaggaccaccgcggccgggtcgacagccacggcaacgagctgcggctcaccgtc
accgccaccgccgacgaactcgccgccgccgccgacctggtgaagggcaaggccaccggc
accccggtcgccgtcgtccgcggcctcggccacctggtcaccccggcggacggcgacggc
gcccgcgccctggtccgcgcccccgggcaggacatgttccggctcggcacctccgaggcg
gtccgcgaggccgtcaccctccggcggacggtccgcgccttcaccgacgaacccgtcgac
ggcgacgcggtgcgccgggccgtcgccgccgcgatcaccgcccccgccccgcaccacacc
acgccctggcggttcgtcctgctcgaaacggccggggcccgcacccggctgctcgacgcg
atgctcgccgcctggcagcgcgacctgcgcgaactcgacggctggagcgaggagcggatc
gcccggcgcaccgcccgcggcgaggtgctgcgcggcgcgccctacctggtcgtcccctgc
ctggtcgcggacggctcgcacgcctaccccgacccgcggcgggccgccgccgaacgggag
atgttcgtggtcgcggtcggcgccgccgtgcagaacctgctggtcaccctcggcggcgag
gggtacgggtcggcgtgggtctcctcgacgatgttctgccgcgacaccgtgcgggaggcg
ctggagctgccggccgactgggacccgatgggcgcggtcgccgtggggcgggcggccgaa
caaccgagagaccgtcagccgcgcccggcggacgacttcctgacggtgcgctag

DBGET integrated database retrieval system