KEGG   Kitasatospora setae: KSE_30270Help
Entry
KSE_30270         CDS       T01648                                 

Gene name
deoA
Definition
putative thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ksk  Kitasatospora setae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KSE_30270 (deoA)
Enzymes [BR:ksk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     KSE_30270 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3410743..3412020)
Genome map
AA seq 425 aa AA seqDB search
MDAISVIRAKRDRGELTDPQIDWVIDAYTRGEVADEQMSALAMAILLNGMTPREISRWTD
AMIRSGERMDFTALGVPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRALLSNEEMLDVLRGCGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGALVLDVKVGSGAFMKNLDDARELARTMVGLGRSAGVATVALLTDMS
TPLGLTAGNALEVRESVEVLAGGGPADVVELTLALAREMLTAAGVRGKDPADALRDGSAM
DHWRRMITAQGGDPDAPLPVARERHVVPAPATGVLTALDAYAVGVTAWRLGAGRARKEDP
VQAGAGVELHAKPGDHVTAGQPLLTLHTDTPERLPYALEALTGAVTVAPAGTAFTPAPIV
LDRIG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatctccgtcatccgggccaagcgcgaccggggcgaactgaccgacccccag
atcgactgggtcatcgacgcctacacccgcggcgaggtcgccgacgagcagatgtccgcc
ctcgcgatggcgatcctgctcaacggcatgaccccccgggagatcagccgctggaccgac
gcgatgatccgctccggcgaacggatggacttcaccgcgctcggcgtccccaccgccgac
aagcactccaccggcggcgtcggcgacaagatcaccctcccgctcgccccgctggtcgcc
gcctgcggcgccgccgtcccgcagctctccggccgcggcctcggccacaccggcggcacc
ctcgacaagctggagtccatccccggctggcgggccctgctctccaacgaggagatgctc
gacgtgctgcgcggctgcggcgccgtcatctgcgccgccggcgacgggctcgcccccgcc
gacaagaagctctacgccctccgggacgtcaccggcaccgtcgaggcgatcccgctgatc
gcctcctcgatcatgtccaagaagatcgccgaaggcaccggcgccctcgtcctcgacgtc
aaggtcggctccggcgccttcatgaagaacctcgacgacgcccgcgaactcgcccgcacc
atggtcgggttgggccgctccgccggtgtcgccacggtcgccctgctcaccgacatgtcc
accccgctcggactcaccgccggcaacgcgctcgaagtccgcgaatccgtcgaggtactg
gccggcggcggccccgccgacgtcgtcgaactcaccctcgccctcgcccgcgaaatgctc
accgccgccggcgtccgcggcaaggaccccgccgacgcgctccgcgacggctccgccatg
gaccactggcgccgcatgatcaccgcccagggcggcgaccccgacgcccccctcccggtc
gcccgcgaacggcacgtcgtccccgcccccgccaccggcgtcctcaccgccctcgacgcc
tacgccgtcggcgtcaccgcctggcgcctcggcgccggccgcgcccgcaaggaggacccc
gtccaggccggcgccggcgtcgaactccacgccaagcccggcgaccacgtcaccgccggc
cagcccctgctcaccctgcacaccgacacccccgaacgcctcccctacgccctggaggcc
ctcaccggcgccgtcaccgtcgccccggccggcacggcgttcaccccggcgccgatcgtg
ctggaccggatcggatag

DBGET integrated database retrieval system