KEGG   Kitasatospora setae: KSE_30400Help
Entry
KSE_30400         CDS       T01648                                 

Gene name
sdhD
Definition
putative succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ksk  Kitasatospora setae
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KSE_30400 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KSE_30400 (sdhD)
   00650 Butanoate metabolism
    KSE_30400 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    KSE_30400 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3426753..3427241
Genome map
AA seq 162 aa AA seqDB search
MSTDTNDLVVPSLQAHTAKGLGTGNPADAFVVEPARARTRKTPRRTRTNFEMLAWLFMRL
SGVVLVVLVLGHLLINLMLDGGVSKVSFAFVAGRWASPFWQFWDLLMLWLAMLHGSNGMR
TVINDYAEKDATRLWLKGLLGVATVFTVVLGTLVIFTFDPNI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgtccactgacaccaacgacctggtggttccctccctgcaggcgcacaccgccaagggc
ctgggcaccggcaacccggccgacgccttcgtggtggagcccgcccgggcccgcaccagg
aagaccccgcgccgcacccgcaccaacttcgagatgctcgcctggctgttcatgcgcctg
tcgggtgtcgtcctggtggtgctggtcctcggccacctgctgatcaacctgatgctggac
ggcggcgtctccaaggtgagcttcgccttcgtggcgggccgctgggcgtccccgttctgg
cagttctgggacctgctgatgctgtggctggcgatgctgcacggctccaacggcatgcgc
accgtcatcaacgactacgcggagaaggacgccactcgtctgtggctcaagggtctcctc
ggtgtcgcgaccgtcttcacggtcgtcctcggcaccctggtgatcttcaccttcgacccg
aacatctag

DBGET integrated database retrieval system