KEGG   Kitasatospora setae: KSE_30760Help
Entry
KSE_30760         CDS       T01648                                 

Gene name
sucC
Definition
(GenBank) putative succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ksk  Kitasatospora setae
Pathway
ksk00020  Citrate cycle (TCA cycle)
ksk00640  Propanoate metabolism
ksk00660  C5-Branched dibasic acid metabolism
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01200  Carbon metabolism
Module
ksk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ksk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KSE_30760 (sucC)
   00640 Propanoate metabolism
    KSE_30760 (sucC)
   00660 C5-Branched dibasic acid metabolism
    KSE_30760 (sucC)
Enzymes [BR:ksk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     KSE_30760 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: BAJ28887
NITE: KSE_30760
UniProt: E4NCF6
Position
complement(3465571..3466743)
Genome map
AA seq 390 aa AA seqDB search
MDLFEYQARDLFAKHGVPVLDGDVIETAADAAAIAERFGGRAVVKAQVKVGGRGKAGGVK
LASDPQDVVAKAEAILGMDIKGHTVHKVMLAQTADIQEEYYVSFLLDRTNRTFLAMASVE
GGVEIEVVAEENPDALAKIPVDANEGVTAEKAAEIVAAAKFPAEIADQVADVLQKLWVVF
VKEDALLVEVNPLIKSGDGKIIALDGKVSLDENAEFRQPDHEALEDKAAANPLEAAAKAK
GLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGENHGGVKPANFLDIGGGASAEVMANGLE
IILGDTDVKSVFVNVFGGITACDAVANGIVQALALLEGKGEAVTKPLVVRLDGNNAELGR
QILTDANHPLVEQVDTMDGAADRAAELANK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcgagggacctcttcgccaagcacggtgtacccgtgctt
gacggcgatgtcatcgagaccgccgcagacgctgccgccatcgcggagcgcttcggcggc
cgagccgtcgtcaaggctcaggtgaaggtgggcggccgaggcaaggccggtggcgtgaag
ctcgcgtccgacccgcaggacgtcgtggccaaggccgaggcgatcctcggcatggacatc
aagggccacaccgtccacaaggtcatgctggcccagaccgcggacatccaggaggagtac
tacgtctccttcctgctcgaccgcaccaaccgcaccttcctggcgatggccagcgtcgag
ggcggcgtggagatcgaggtcgtggccgaggagaacccggacgcgctcgccaagatcccg
gtcgacgccaacgagggcgtgaccgcggagaaggccgccgagatcgtggccgccgcgaag
ttcccggccgagatcgccgaccaggtcgccgacgtcctgcagaagctctgggtcgtcttc
gtcaaggaggacgccctcctggtcgaggtcaacccgctgatcaagtccggcgacggcaag
atcatcgcgctcgacggcaaggtctccctggacgagaacgccgagttccgccagcccgac
cacgaggccctcgaggacaaggccgccgccaacccgctggaggcggcggcgaaggccaag
ggcctgaactacgtcaagctcgacggccaggtcggcatcatcggcaacggcgcgggcctc
gtcatgagcaccctggacgtcgtcgcgtacgccggtgagaaccacggcggcgtgaagccg
gccaacttcctcgacatcggcggcggcgcgtccgccgaggtgatggcgaacggcctggag
atcatcctgggcgacaccgacgtcaagtcggtcttcgtcaacgtcttcggcggcatcacc
gcctgtgacgcggtcgccaacggcatcgtgcaggccctcgcgctcctggagggcaagggc
gaggccgtcaccaagccgctggtcgtccgcctggacggcaacaacgcggagctcggtcgc
cagatcctgaccgacgccaaccacccgctggtcgagcaggtggacaccatggacggcgcc
gctgaccgcgccgccgagctggccaacaagtaa

DBGET integrated database retrieval system