KEGG   Kitasatospora setae: KSE_30980Help
Entry
KSE_30980         CDS       T01648                                 

Gene name
choD
Definition
(GenBank) putative cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
ksk  Kitasatospora setae
Pathway
ksk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    KSE_30980 (choD)
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     KSE_30980 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C FAD_binding_2 DAO GMC_oxred_N Pyr_redox_2 NAD_binding_8 GIDA FAD_binding_3 Pyr_redox HI0933_like FAD_oxidored Fer4_9 Fer4_10 Thi4 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: BAJ28908
NITE: KSE_30980
UniProt: E4NCH7
Position
complement(3494490..3496250)
Genome map
AA seq 586 aa AA seqDB search
MSYDYDVVVVGSGFGGSVAALRLTEKGYRVAVLEAGRRFRREELPSTSWNLRDYLWAPAL
GRYGIQRIHLLRNVLILAGAGVGGGSLNYANTLYVPPKAFFEDRQWRHITDWQAELDPFY
DQARRMLGVRLNPTMTPSDVHLKAAAEAMGCGDTFHLAPVGVFFGDGRDGTGEAKAAPGG
EVDDPYFGGAGPKRRACTECGECMTGCRHGAKNTLTENYLYLAERAGAEIRPMTTVARLR
PHGDGYAVDTLPTDARTRRARKAGARTITAERVVVAAGTYGTQTLLHRMRAGGQLPRISA
RLGHLTRTNSEALVGAQTSTRRYGERPDFTRGVAITSSVHPDANTHIEPVRYGRGSNAMG
ALSIQQVPGAGRGPRWLRYLGTAARHPWTFVQSMNQHRWSEKTIIGLVMQSLDNSLTVSL
KNGKLTSRQGHGAPNPSWIPAAEEGARALAASINGFPGSTAGEIFDIPLTAHFLGGCPIG
DSAETGVVDPYHRLYGHPGISVVDGSAVSANLGVNPSLTITAQAERAMSMWPNRGEADPR
PEPGAGYRPVPPVAPRQPAVPAGAFGALRLPLLPVPKVPGRAPEGD
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtacgactacgacgtcgtggtggtcggttcgggcttcggcggctcggtcgcggcc
ctgcggctcaccgagaagggctaccgggtcgccgtcctggaggccgggcgcaggttccgc
cgcgaggaactgcccagcacctcctggaacctgcgcgactacctgtgggcacccgccctc
ggccgctacggcatccagcgcatccacctgctgcgcaacgtgctgatcctggccggggcg
ggcgtcggcggcggctcgctgaactacgccaacaccctgtacgtcccgccgaaggcgttc
ttcgaggaccggcagtggcggcacatcaccgactggcaggccgagctcgacccgttctac
gaccaggcccggcggatgctcggcgtccggctcaaccccacgatgacgccctccgacgtg
cacctgaaggccgccgccgaggcgatgggctgcggcgacaccttccacctggcgccggtc
ggggtgttcttcggcgacgggcgggacggcaccggcgaggccaaggccgcgcccggcggc
gaggtcgacgacccgtacttcggcggcgccgggccgaagcgccgggcctgcaccgagtgc
ggcgagtgcatgaccggctgccggcacggcgccaagaacaccctcaccgagaactacctg
tacctggccgagcgggccggcgccgagatccggccgatgaccaccgtcgcccggctgcgc
ccgcacggcgacggctacgccgtcgacacgctgcccaccgacgcccgcacccggcgggcc
cggaaggccggggcgcgcacgatcaccgccgaacgggtggtcgtcgcggccggcacctac
ggcacccagacgctgctgcaccggatgcgcgcgggcggccagctgccccggatctccgcc
cggctcggccacctcacccgcaccaactcggaggcgctggtcggcgcgcagacctccacc
cggcgctacggcgaacgccccgacttcacccgcggcgtcgccatcacctcctccgtgcac
cccgacgcgaacacccacatcgagccggtccgctacgggcggggctccaacgcgatgggc
gcgctctccatccagcaggtgcccggcgccgggcgcggaccgcgctggctgcgctacctc
ggcaccgccgcccggcacccgtggaccttcgtccagtcgatgaaccagcaccgctggtcc
gagaagaccatcatcggcctggtcatgcagtccctcgacaactcgctgaccgtctcgctg
aagaacggcaagctcacctcccggcagggccacggcgcgcccaaccccagctggatcccg
gccgccgaggagggcgcccgggcgctcgccgcctccatcaacggcttccccggctccacc
gccggcgagatcttcgacatcccgctcaccgcgcacttcctcggcggctgcccgatcggc
gacagcgccgagaccggcgtcgtcgacccctaccaccggctgtacgggcacccggggatc
agcgtcgtcgacggctccgcggtctccgccaacctgggcgtcaacccctcgctgacgatc
accgcccaggccgagcgcgccatgtccatgtggcccaaccgcggcgaggccgacccgcgc
cccgaaccgggcgccggctaccgcccggtgccgcccgtcgcaccgcgccaacccgccgtc
cccgcaggggcgttcggcgcgctgcgactgccgctgctgcccgtccccaaggtgccggga
cgggcccccgaaggcgattga

DBGET integrated database retrieval system