KEGG   Kitasatospora setae: KSE_30980Help
Entry
KSE_30980         CDS       T01648                                 

Gene name
choD
Definition
putative cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ksk  Kitasatospora setae
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    KSE_30980 (choD)
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     KSE_30980 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3494490..3496250)
Genome map
AA seq 586 aa AA seqDB search
MSYDYDVVVVGSGFGGSVAALRLTEKGYRVAVLEAGRRFRREELPSTSWNLRDYLWAPAL
GRYGIQRIHLLRNVLILAGAGVGGGSLNYANTLYVPPKAFFEDRQWRHITDWQAELDPFY
DQARRMLGVRLNPTMTPSDVHLKAAAEAMGCGDTFHLAPVGVFFGDGRDGTGEAKAAPGG
EVDDPYFGGAGPKRRACTECGECMTGCRHGAKNTLTENYLYLAERAGAEIRPMTTVARLR
PHGDGYAVDTLPTDARTRRARKAGARTITAERVVVAAGTYGTQTLLHRMRAGGQLPRISA
RLGHLTRTNSEALVGAQTSTRRYGERPDFTRGVAITSSVHPDANTHIEPVRYGRGSNAMG
ALSIQQVPGAGRGPRWLRYLGTAARHPWTFVQSMNQHRWSEKTIIGLVMQSLDNSLTVSL
KNGKLTSRQGHGAPNPSWIPAAEEGARALAASINGFPGSTAGEIFDIPLTAHFLGGCPIG
DSAETGVVDPYHRLYGHPGISVVDGSAVSANLGVNPSLTITAQAERAMSMWPNRGEADPR
PEPGAGYRPVPPVAPRQPAVPAGAFGALRLPLLPVPKVPGRAPEGD
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtacgactacgacgtcgtggtggtcggttcgggcttcggcggctcggtcgcggcc
ctgcggctcaccgagaagggctaccgggtcgccgtcctggaggccgggcgcaggttccgc
cgcgaggaactgcccagcacctcctggaacctgcgcgactacctgtgggcacccgccctc
ggccgctacggcatccagcgcatccacctgctgcgcaacgtgctgatcctggccggggcg
ggcgtcggcggcggctcgctgaactacgccaacaccctgtacgtcccgccgaaggcgttc
ttcgaggaccggcagtggcggcacatcaccgactggcaggccgagctcgacccgttctac
gaccaggcccggcggatgctcggcgtccggctcaaccccacgatgacgccctccgacgtg
cacctgaaggccgccgccgaggcgatgggctgcggcgacaccttccacctggcgccggtc
ggggtgttcttcggcgacgggcgggacggcaccggcgaggccaaggccgcgcccggcggc
gaggtcgacgacccgtacttcggcggcgccgggccgaagcgccgggcctgcaccgagtgc
ggcgagtgcatgaccggctgccggcacggcgccaagaacaccctcaccgagaactacctg
tacctggccgagcgggccggcgccgagatccggccgatgaccaccgtcgcccggctgcgc
ccgcacggcgacggctacgccgtcgacacgctgcccaccgacgcccgcacccggcgggcc
cggaaggccggggcgcgcacgatcaccgccgaacgggtggtcgtcgcggccggcacctac
ggcacccagacgctgctgcaccggatgcgcgcgggcggccagctgccccggatctccgcc
cggctcggccacctcacccgcaccaactcggaggcgctggtcggcgcgcagacctccacc
cggcgctacggcgaacgccccgacttcacccgcggcgtcgccatcacctcctccgtgcac
cccgacgcgaacacccacatcgagccggtccgctacgggcggggctccaacgcgatgggc
gcgctctccatccagcaggtgcccggcgccgggcgcggaccgcgctggctgcgctacctc
ggcaccgccgcccggcacccgtggaccttcgtccagtcgatgaaccagcaccgctggtcc
gagaagaccatcatcggcctggtcatgcagtccctcgacaactcgctgaccgtctcgctg
aagaacggcaagctcacctcccggcagggccacggcgcgcccaaccccagctggatcccg
gccgccgaggagggcgcccgggcgctcgccgcctccatcaacggcttccccggctccacc
gccggcgagatcttcgacatcccgctcaccgcgcacttcctcggcggctgcccgatcggc
gacagcgccgagaccggcgtcgtcgacccctaccaccggctgtacgggcacccggggatc
agcgtcgtcgacggctccgcggtctccgccaacctgggcgtcaacccctcgctgacgatc
accgcccaggccgagcgcgccatgtccatgtggcccaaccgcggcgaggccgacccgcgc
cccgaaccgggcgccggctaccgcccggtgccgcccgtcgcaccgcgccaacccgccgtc
cccgcaggggcgttcggcgcgctgcgactgccgctgctgcccgtccccaaggtgccggga
cgggcccccgaaggcgattga

DBGET integrated database retrieval system