KEGG   Kitasatospora setae: KSE_31790Help
Entry
KSE_31790         CDS       T01648                                 

Gene name
rmlC
Definition
putative dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ksk  Kitasatospora setae
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    KSE_31790 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KSE_31790 (rmlC)
Enzymes [BR:ksk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     KSE_31790 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3572671..3573270
Genome map
AA seq 199 aa AA seqDB search
MRFRELSIPGAFEVTPQQHGDPRGLFMEWYRFDKLSEVVGHPLRLAQGNLSVSAKNVVRG
VHFADVPPGQAKYVSCVRGAVLDVVVDLRVGSPAFGRWEFVRLDETDRRSVYLPEGLGHG
FCALTDDATLSYVCSETYNPTGEHGVHPLDPDLGIEWPVEVPQLSAKDEQAPTLAEALAS
GLLPDYRACLEFTASLGGV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttccgcgaactgtcgatcccgggggccttcgaggtgaccccgcagcagcacggc
gacccccgtggcctgttcatggagtggtaccgcttcgacaagctgtcggaggtggtcggc
cacccgctgcggctggcccagggcaacctgtcggtgtccgcgaagaatgtggtgcgcggc
gtgcacttcgccgacgtcccgcccggccaggccaagtacgtcagctgcgtgcgcggcgcg
gtgctggacgtggtggtggacctgcgggtcggctcccccgcgttcggccgctgggagttc
gtccggctggacgagaccgaccgccgctcggtgtacctgccggagggcctgggccacggc
ttctgcgcgctgaccgacgacgccacgctgtcgtacgtctgctccgagacctacaacccg
accggcgagcacggcgtgcacccgctggacccggacctcggcatcgagtggccggtggag
gtcccgcagctctccgcgaaggacgagcaggccccgacgctcgccgaggcgctggcctcc
ggcctgctgcccgactaccgggcctgcctggagttcacggcctcgctcggcggggtctga

DBGET integrated database retrieval system