KEGG   Kitasatospora setae: KSE_33610Help
Entry
KSE_33610         CDS       T01648                                 

Gene name
cobA_hemD
Definition
putative uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ksk  Kitasatospora setae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ksk00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3762197..3763816)
Genome map
AA seq 539 aa AA seqDB search
MTAAGFHPPAGRCTFLGAGPGDPGLLTLRAVDVLGTADVLIADPLTAAAVRTHCPSGVQV
IDPADAGKELADLAADAVKAGRHLVRTVDGDPGLDGCAAQEMLRCAKAGVPFEVVPGVAQ
SVGVPAYAGVPLRGGQGADVRFVDAEALLAGQVVDLGVPETTLVVRTTLGQLPATANALV
AHGRKPDAALSATLSGTTTRQRTFTSTLAAIAADLKAARVLPSPVSAPVDPATSVIAVVG
AQVAHRASHSWFETKPLFGWNVLVPRTKEQAHGLSEQLRSYGAVPQEVPTIAVEPPRTPQ
QMERAIKGLVTGRYEWIAFTSVNAVKAVREKFEEYGLDARAFAGIKVAAVGETTAQALVD
FGVKPDLVPSGEQSAAGLLEDWPPYDPVFDPIDRVLLPRADIATETLVAGLVELGWEVDD
VTAYRTVRASPPPAETREAIKGGGFDAVLFTSSSTVRNLVGIAGKPHNVTVIACIGPATA
KTAEEHGLRVDVMAPAPSASALAQALADFGATRRDAATAAGEPVYRPSERRPGSRRKAR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgccggattccacccgcccgcagggcgctgcaccttcctcggagccggcccc
ggcgaccccggactgctcaccctgcgcgccgtcgacgtgctcggcaccgccgacgtgctg
atcgccgacccgctgaccgccgccgcggtccgcacccactgccccagcggcgtccaggtc
atcgacccggccgacgccggcaaggaactggccgacctggccgccgacgccgtcaaggcc
ggccgccacctggtccgcaccgtcgacggcgaccccggcctggacggctgcgccgcccag
gagatgctgcgctgcgccaaggccggtgtgccgttcgaggtcgtccccggcgtcgcccag
tcggtgggcgtgcccgcctacgcgggcgtgccgttgcgcggcggccagggcgccgacgtc
cggttcgtggacgccgaggcgctgctggccggccaggtcgtcgacctgggcgtgccggag
accaccctggtggtccgcaccaccctgggccagctgcccgcgaccgccaacgcgctggtc
gcgcacggccgcaagcccgacgcggcgctctccgcgacgctctccggcaccaccacccgg
cagcgcaccttcacctccacgctggccgccatcgccgccgacctgaaggccgcccgggtg
ctgccctcgccggtctccgccccggtggacccggcgacctcggtgatagccgtggtgggc
gcgcaggtcgcccaccgggcctcgcactcgtggttcgagaccaagccgctgttcggctgg
aacgtgctcgtcccgcgcaccaaggagcaggcccacggcctctccgagcagctccgctcg
tacggcgcggtgccgcaggaggtgccgaccatcgcggtcgagccgccgcgcaccccgcag
cagatggagcgggccatcaagggcctggtcaccggccgctacgagtggatcgccttcacc
tcggtgaacgccgtcaaggccgtccgggagaagttcgaggagtacggcctggacgcccgg
gcgttcgccggcatcaaggtcgcggcggtcggcgagaccaccgcgcaggcgctggtcgac
ttcggcgtcaagcccgacctggtgccctccggcgagcagtccgccgccggcctgctggag
gactggccgccgtacgacccggtgttcgacccgatcgaccgggtgctgctgccgcgcgcc
gacatcgccaccgagaccctggtggccggcctggtcgagctcggctgggaggtcgacgac
gtgaccgcgtaccgcacggtgcgcgcctcgccgccgccggccgagacccgggaggcgatc
aagggcggcggcttcgacgcggtgctgttcacctcgtcctcgaccgtccggaacctggtc
ggcatcgccggcaagccgcacaacgtgaccgtcatcgcctgcatcggtccggccaccgcc
aagacggcggaggagcacggcctgcgggtggacgtgatggccccggccccgtccgcgtcc
gcgctcgcccaggcgctggccgacttcggggccacccgccgggacgccgccaccgcggcg
ggcgagccggtctaccggccgagcgaacgccgccccggctcgcgccgcaaggcgcgctga

DBGET integrated database retrieval system