KEGG   Kitasatospora setae: KSE_34550Help
Entry
KSE_34550         CDS       T01648                                 

Gene name
gpm
Definition
(RefSeq) putative phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ksk  Kitasatospora setae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KSE_34550 (gpm)
   01230 Biosynthesis of amino acids
    KSE_34550 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_34550 (gpm)
  Energy metabolism
   00680 Methane metabolism
    KSE_34550 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_34550 (gpm)
Enzymes [BR:ksk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KSE_34550 (gpm)
Exosome [BR:ksk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KSE_34550 (gpm)
  Exosomal proteins of melanoma cells
   KSE_34550 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3866873..3867631)
Genome map
AA seq 252 aa AA seqDB search
MADTTYRLILLRHGESQWNQKNLFTGWVDVDLNEKGEKEAARGGELLLAEGLLPDVLHTS
LLRRAIRTSQIALDKADRHWIPVRRSWRLNERHYGALQGKDKAQTLAEFGEEQFQLWRRS
YDTPPPALADDAEYSQAGDARYAEIPSELRPNTECLKDVVERMLPYWYDAIVPDLAAGNT
VLVTAHGNSLRALVKHLDGISDEAIAGLNIPTGIPLVYELDADFKPLAAGGRYLDPDAAA
AAIEAVKNQGKK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctgacacgacctatcgcttgatcctgctccgccacggcgagagccagtggaaccag
aagaacctgttcaccggttgggtcgacgtcgacctcaacgagaagggcgagaaggaggcc
gcccgcggcggcgaactcctgctggccgagggcctgctgccggacgtgctgcacacctcg
ctgctgcgccgcgcgatccgcacctcgcagatcgccctcgacaaggccgaccggcactgg
atcccggtccgccgcagctggcgcctgaacgagcgccactacggcgccctccagggcaag
gacaaggcccagaccctcgccgagttcggcgaggagcagttccagctctggcgccgctcc
tacgacaccccgccgccggccctggccgacgacgccgagtactcgcaggccggcgacgcc
cgctacgccgagatcccgtccgagctgcgcccgaacaccgagtgcctcaaggacgtcgtc
gagcggatgctcccgtactggtacgacgccatcgtgccggacctcgcggcgggcaacacc
gtcctggtcaccgcccacggcaacagcctgcgcgccctggtcaagcacctggacggcatc
tccgacgaggccatcgccggcctcaacatccccaccggcatcccgctcgtctacgagctc
gacgccgacttcaagccgctcgccgccggcggccgctacctcgaccccgacgccgccgcg
gccgccatcgaggccgtgaagaaccagggcaagaagtag

DBGET integrated database retrieval system