KEGG   Kitasatospora setae: KSE_36660Help
Entry
KSE_36660         CDS       T01648                                 

Gene name
recR
Definition
putative recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ksk  Kitasatospora setae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ksk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4091293..4091892)
Genome map
AA seq 199 aa AA seqDB search
MYEGVVQDLIDELGRLPGVGPKSAQRIAFHILQADPVDVRRLAHALQQVKEKVRFCAVCG
NVAEAERCRVCLDPRRDLAVICVVEESKDVVAIERTREFRGRYHVLGGAISPIEGVGPDD
LRIRELMTRLADGTVTELILATDPNLEGEATATYLARLCKPMGLKVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLLDV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgagggcgtggtgcaggacctgatcgacgagctgggcaggctgcccggggtcggt
ccgaagagcgcccagcggatcgccttccacatcctgcaggccgatccggtggacgtgcgc
cggctggcgcacgcgctgcagcaggtgaaggagaaggtccggttctgcgcggtctgcggc
aacgtcgcggaggccgagcggtgccgggtctgcctggacccgcgccgggacctcgcggtg
atctgcgtggtggaggagtccaaggacgtggtggcgatcgagcggacccgcgagttccgc
ggccgctaccacgtgctgggcggggcgatcagcccgatcgagggggtcggcccggacgac
ctgcggatccgcgagctgatgacccggctcgcggacggcacggtcaccgagctgatcctg
gccaccgaccccaacctggagggggaggcgaccgcgacctacctggcccggctgtgcaag
ccgatgggcctcaaggtcacccggctggcgagcggactgcccgtcggcggggacttggag
tacgccgacgaggtcaccctcggccgggcgttcgaagggagacgactgctcgatgtctga

DBGET integrated database retrieval system