KEGG   Kitasatospora setae: KSE_36840Help
Entry
KSE_36840         CDS       T01648                                 

Definition
putative aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ksk  Kitasatospora setae
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KSE_36840
Enzymes [BR:ksk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KSE_36840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4106495..4107163
Genome map
AA seq 222 aa AA seqDB search
MMTDATGRRSRADGLVEAARELFAAGVMSHSGHANLSARIDGDRFLLTPGYVRGLTAGQL
AVVGLDGRLLEGELRSVSAEITTMHAAVYRARPGVGAVVHTHSPATTAFAVAHRPLPCRT
EPMLRFGQPEEVPVVPWGPRGSDVSVRGIADVLERRPTTSAVLLANHGPLVFGPDPDAAW
RLVVAIEESAEAELAAAAIGGAVDFPPGALADVRASIARAAS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacggatgcgacgggccggcggagccgggcggacgggctggtcgaggcggcccgg
gagctcttcgcggcgggggtgatgtcgcactccgggcacgccaacctgagcgcccggatc
gacggcgaccgcttcctgctgaccccggggtacgtacgcggcctgacggccgggcagttg
gcggtggtcgggctcgacgggcggctgctggagggcgaactgcggtcggtcagcgccgag
atcaccaccatgcacgccgccgtctaccgggcccggcccggggtcggcgcggtcgtgcac
acccactcgcccgccacgaccgccttcgcggtggcgcaccggccgctgccctgccgcacc
gagccgatgctgcgcttcgggcagcccgaggaggtgccggtggtgccctgggggccgcgc
gggtcggacgtgtcggtgcggggcatcgcggacgtgctggagcggcgtccgaccacctcg
gcggtgctgctggccaaccacgggccgctggtgttcggcccggacccggacgcggcctgg
cggctggtggtcgcgatcgaggagagcgccgaggccgagctggccgccgccgcgatcggc
ggggcggtggacttcccgcccggcgcgctggcggacgtccgggcctcgatcgcccgggcc
gcgtcgtga

DBGET integrated database retrieval system