KEGG   Kitasatospora setae: KSE_36840Help
Entry
KSE_36840         CDS       T01648                                 

Definition
(GenBank) putative aldolase
  KO
K03077  
L-ribulose-5-phosphate 4-epimerase [EC:5.1.3.4]
Organism
ksk  Kitasatospora setae
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KSE_36840
   00053 Ascorbate and aldarate metabolism
    KSE_36840
Enzymes [BR:ksk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.4  L-ribulose-5-phosphate 4-epimerase
     KSE_36840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
4106495..4107163
Genome map
AA seq 222 aa AA seqDB search
MMTDATGRRSRADGLVEAARELFAAGVMSHSGHANLSARIDGDRFLLTPGYVRGLTAGQL
AVVGLDGRLLEGELRSVSAEITTMHAAVYRARPGVGAVVHTHSPATTAFAVAHRPLPCRT
EPMLRFGQPEEVPVVPWGPRGSDVSVRGIADVLERRPTTSAVLLANHGPLVFGPDPDAAW
RLVVAIEESAEAELAAAAIGGAVDFPPGALADVRASIARAAS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacggatgcgacgggccggcggagccgggcggacgggctggtcgaggcggcccgg
gagctcttcgcggcgggggtgatgtcgcactccgggcacgccaacctgagcgcccggatc
gacggcgaccgcttcctgctgaccccggggtacgtacgcggcctgacggccgggcagttg
gcggtggtcgggctcgacgggcggctgctggagggcgaactgcggtcggtcagcgccgag
atcaccaccatgcacgccgccgtctaccgggcccggcccggggtcggcgcggtcgtgcac
acccactcgcccgccacgaccgccttcgcggtggcgcaccggccgctgccctgccgcacc
gagccgatgctgcgcttcgggcagcccgaggaggtgccggtggtgccctgggggccgcgc
gggtcggacgtgtcggtgcggggcatcgcggacgtgctggagcggcgtccgaccacctcg
gcggtgctgctggccaaccacgggccgctggtgttcggcccggacccggacgcggcctgg
cggctggtggtcgcgatcgaggagagcgccgaggccgagctggccgccgccgcgatcggc
ggggcggtggacttcccgcccggcgcgctggcggacgtccgggcctcgatcgcccgggcc
gcgtcgtga

DBGET integrated database retrieval system