KEGG   Kitasatospora setae: KSE_38650Help
Entry
KSE_38650         CDS       T01648                                 

Gene name
bkdH
Definition
putative dihydrolipoamide acyltransferase E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ksk  Kitasatospora setae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KSE_38650 (bkdH)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_38650 (bkdH)
   00020 Citrate cycle (TCA cycle)
    KSE_38650 (bkdH)
   00620 Pyruvate metabolism
    KSE_38650 (bkdH)
Enzymes [BR:ksk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KSE_38650 (bkdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4304029..4305453)
Genome map
AA seq 474 aa AA seqDB search
MTTDVHSLREFKMPDVGEGLTEAEILTWYVKPGDTVTDGQVVCEVETAKAAVELPIPFTG
VVEALHFPAGTTVDVGTSIIAVAVAGAAPAAPTAAAPAAAPAASAASAAEPEPERREVLV
GYGPRTGSAQRRARRTNGAAAAPAVPAAPAVPAVPVTPVAPVAEGERPLAKPPVRKLAKD
LGIDLRAVVPTGPNGVITREDVHAAANTAAEAVVEPVAAAPAPAAEPVAPAAAPVSVPNA
AGDVRVPVKGVRKATAQAMVASAFTAPHVTEFVQVDVTRTMKLVRKLKESGELGAGVRVS
PLLLVAKALLTAVKRHPEINASWDEPAQEIVIRGAVNLGIAAATPRGLIVPNIKDAGSRT
LSQLAVALGELVETARQGKTSPADMAGGSITITNVGVFGVDTGTPILNPGEAAILAFGAV
RELPWVHKGKVVPRQVTTLALSFDHRLVDGELGSKVLADTAAILEYPKRLITWG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgacgtccactcgctccgcgagttcaagatgcccgacgtgggcgagggcctc
accgaggccgagatcctcacctggtacgtgaagccgggcgacaccgtcaccgacgggcag
gtggtctgcgaggtggagaccgccaaggccgccgtcgaactgccgatcccgttcaccggc
gtggtcgaggcgctgcacttcccggcgggcaccaccgtcgacgtcggcacctcgatcatc
gcggtcgccgtcgccggcgccgctccggccgcgcccacggcggccgctcccgccgccgct
ccggcggcctcggcggcctcggcggccgagccggagccggagcgccgcgaggtgctggtc
ggctacgggccgcgcaccggctcggcgcagcgccgggcccggcgcaccaacggcgccgcc
gccgcgccggccgtgcccgccgcgccggccgtgcccgccgtgccggtcaccccggtcgcc
ccggtggccgagggggagcgcccgctggccaagccgccggtgcgcaagctcgccaaggac
ctcgggatcgacctgcgcgccgtggtgccgaccggcccgaacggcgtgatcacccgcgag
gacgtgcacgccgcggcgaacaccgccgccgaggcggtcgtcgagccggtggccgcggcc
cccgcgccggcggccgagccggtcgccccggcggcggcgccggtgtcggtgccgaacgcg
gccggggacgtccgggtgccggtgaagggcgtgcggaaggcgaccgcgcaggcgatggtg
gcctccgcgttcaccgcgccgcacgtcaccgagttcgtccaggtggacgtgacccggacg
atgaagctggtccgcaagctcaaggagagcggcgagctgggcgccggggtgcgggtcagc
ccgctgctgctggtggcgaaggcgctgctcaccgccgtcaagcggcacccggagatcaac
gccagctgggacgagccggcccaggagatcgtcatccggggcgcggtcaacctcgggatc
gccgcggccaccccgcgcggcctgatcgtcccgaacatcaaggacgcgggctcccggacg
ctctcgcaactggcggtcgcgctcggtgagttggtggagaccgcgcggcagggcaagacc
tcgccggccgacatggcgggcggcagcatcacgatcaccaacgtcggcgtcttcggcgtc
gacaccggcaccccgatcctgaacccgggcgaggcggccatcctggccttcggcgccgtc
cgggagctgccctgggtgcacaagggcaaggtggtgccccggcaggtcaccacgctggcg
ctgtccttcgaccaccggctggtcgacggcgagctcggctccaaggtgctggcggacacc
gccgcgatcctggagtacccgaagcgcctgatcacctggggctga

DBGET integrated database retrieval system