KEGG   Kitasatospora setae: KSE_39730Help
Entry
KSE_39730         CDS       T01648                                 

Gene name
bkdC
Definition
(GenBank) putative dihydrolipoamide acyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ksk  Kitasatospora setae
Pathway
ksk00010  Glycolysis / Gluconeogenesis
ksk00020  Citrate cycle (TCA cycle)
ksk00620  Pyruvate metabolism
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01200  Carbon metabolism
Module
ksk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_39730 (bkdC)
   00020 Citrate cycle (TCA cycle)
    KSE_39730 (bkdC)
   00620 Pyruvate metabolism
    KSE_39730 (bkdC)
Enzymes [BR:ksk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KSE_39730 (bkdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: BAJ29769
NITE: KSE_39730
UniProt: E4NEI3
Position
4434715..4436019
Genome map
AA seq 434 aa AA seqDB search
MAVPVVREFRLPDLGEGLTGAEVVRWMVEVGEVIAVDQPVVEVETAKAVVEVPCPYGGVV
TARYGEVGQEVPVGAPLVTVAVPPAPGGAPGGADEPAVERPLVGYGVAETRRPGRRRVLP
GGAGPAPAAVPVPAAAPAVVAVISPLVRRLAREHGLDLAAVAGSGPDGLVTRRDVERAIL
ATAVPEKTAVPRGTGPAAGAAGAAAGPDGELVPLRGLRRAVAEKLTRSHREIPAATCWVD
ADATGLTELRAELNRVPGPKVSVLALLARICLAGLERFPELNASVEGEALRRHPAVHLGF
AAQGPRGLLVPVLRDAGRLGTERLSAELARLTEGARAGSLGPAELTGGTFTLNNYGVFGV
DGSTPLLNHPEAAMLGVGRITAKPWVHEGELAVRQVVQLSFTFDHRVCDGGTAGGFLRFV
ADCVERPGLLLRAL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgccggtggtccgcgagttcaggctgcccgacctcggtgagggcctcaccggg
gcggaggtggtgcgctggatggtcgaggtcggcgaggtgatcgccgtcgaccagccggtg
gtggaggtggagaccgccaaggcggtcgtcgaggtgccctgcccgtacggcggggtggtc
accgcgcggtacggcgaggtcgggcaggaggtgccggtcggcgccccgctggtgaccgtc
gccgtcccgcccgcgcccggcggcgccccgggcggcgcggacgagccggcggtggagcgg
ccgctggtcggctacggggtcgccgagacccggcggcccggccggcggcgggtgctgccg
gggggcgccgggccggcccctgccgccgtccccgtccccgccgcggctccggcggtggtc
gcggtgatctcgccgctggtgcgccggctggcccgcgagcacggcctcgacctggccgcg
gtggccggcagcgggccggacgggctggtcacccggcgggacgtggagcgggcgatcctg
gcgaccgccgtcccggagaagaccgctgttccacgtggaaccggcccggcggccggggcg
gccggggcggccgcgggcccggacggcgagctggtgccgctgcgcgggctgcgccgggcg
gtcgccgagaagctgacccgcagccaccgggagatccccgccgcgacctgctgggtggac
gccgacgcgaccggactgacggagctgcgcgccgagttgaaccgggtgccgggcccgaag
gtgagcgtgctggccctgctggcccggatctgcctggccggcctggagcgcttccccgag
ctgaacgcgagcgtcgagggcgaggcgctgcgccgccaccccgccgtgcacctgggcttc
gccgcgcagggcccgcgcggcctgctggtgccggtgctccgggacgccgggcggctgggc
accgagcggctctccgccgaactggcccggctgaccgagggggcccgggcgggcagcctc
ggcccggccgagctgaccggcgggacgttcaccctgaacaactacggcgtcttcggggtg
gacgggtcgacgccgctcctgaaccacccggaggcggcgatgctcggggtcggccggatc
accgccaaaccgtgggtgcacgagggcgagttggcggtccgccaggtcgtccagctgtcc
ttcaccttcgaccaccgggtctgcgacggcggcacggcgggcgggttcctgcggttcgtc
gcggactgcgtggagcggccggggctgctgctgcgggcgctctga

DBGET integrated database retrieval system