KEGG   Kitasatospora setae: KSE_40060Help
Entry
KSE_40060         CDS       T01648                                 

Gene name
trpB2
Definition
(GenBank) putative tryptophan synthase beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ksk  Kitasatospora setae
Pathway
ksk00260  Glycine, serine and threonine metabolism
ksk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01130  Biosynthesis of antibiotics
ksk01230  Biosynthesis of amino acids
Module
ksk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_40060 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KSE_40060 (trpB2)
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KSE_40060 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAJ29800
NITE: KSE_40060
UniProt: E4NEL4
Position
4464177..4465469
Genome map
AA seq 430 aa AA seqDB search
MTRHDTDPTPTAWYDIRPDLPAPVPPMLHPGTKEPVTADDLAPLFPAELAAQELGGPREV
DIPGAVLDLYRRFRPAPLVRAERLERALRTPARIYYKYEGGNPTGSHKLNTALAQAYYNK
AAGVTGLVTETGAGQWGSALGLACSFLELDCEVFMVRVSYDQKPYRRALMETYGAAVHAS
PSELTAAGRAALAADPAATGSLGLAISEAVERVAAAGGRAKYALGSVLNHVLLHQTVIGQ
EALAQFARIGDYPDVVIGAAGGGSNFGGLAFPFLGEQLAGRRPVRAVAVEPASCPSLTRG
RYDYDFGDSAGTTPLMKMHTLGHGFTPPAIHAGGLRYHGMSPIVSHLKELGLIEAVAVPQ
TACFEAGVAFARAEGVVPAPESTHAVRAAVDEALACRESGESKAIVFALSGHGHFDMQAY
LDHFAGRLTD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacccggcacgacaccgacccgacccccaccgcctggtacgacatccgaccggacctg
cccgcgccggtcccgccgatgctgcaccccggcaccaaggaaccggtcaccgccgacgac
ctggccccgctgttccccgccgaactggccgcccaggagctcggcggcccgcgcgaggtc
gacatccccggcgccgtcctcgacctgtaccgccgcttccgccccgcgccgctggtccgc
gccgagcggctggaacgcgcgctgcgcacccccgcccggatctactacaagtacgagggc
ggcaacccgaccggctcgcacaagctcaacaccgcgctggcgcaggcgtactacaacaag
gcggccggggtgaccggcctggtcaccgagaccggcgccgggcagtggggcagcgcgctc
ggcctggcctgctccttcctggagctggactgcgaggtcttcatggtccgggtctcctac
gaccagaagccgtaccggcgggccctgatggagacctacggcgccgcggtgcacgcctcg
ccgtccgagctgaccgccgccgggcgggccgcgctggcggccgacccggcggccaccggc
agcctcggcctggcgatctccgaggcggtcgagcgggtcgcggcggccggcggccgggcc
aagtacgcgctcggctcggtgctcaaccacgtgctgctgcaccagaccgtgatcggccag
gaggcgctggcccagttcgcccggatcggcgactacccggacgtggtgatcggcgcggcc
ggcggcggctccaacttcggcggcctggccttcccgttcctgggcgagcagttggcgggc
cgccgcccggtgcgggcggtcgcggtcgagcccgcgtcctgcccctcgctgacccgcggc
cgctacgactacgacttcggcgacagcgccggcaccaccccgctgatgaagatgcacacc
ctcgggcacggcttcaccccgcccgcgatccacgccggcgggctgcgctaccacggcatg
tcgccgatcgtcagccacctcaaggagctcgggctgatcgaggccgtcgccgtgccgcag
accgcctgcttcgaggcgggcgtggccttcgcccgggccgagggcgtggtccccgcgccg
gagtccacccacgcggtgcgggcggcggtcgacgaggcgctggcctgccgggagtccggc
gagtcgaaggcgatcgtgttcgcgctctccggacacgggcacttcgacatgcaggcgtac
ctggaccacttcgccggccggctcaccgactga

DBGET integrated database retrieval system