KEGG   Kitasatospora setae: KSE_43830Help
Entry
KSE_43830         CDS       T01648                                 

Gene name
folE
Definition
putative GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ksk  Kitasatospora setae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KSE_43830 (folE)
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KSE_43830 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4847928..4848533
Genome map
AA seq 201 aa AA seqDB search
MIDPVTLDGEQPVREFDQKRAENAVRELLIAVGEDPDREGLLETPARVARAYREIFAGLW
QRPEDVLTTTFDLGHDEMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPSASGKITGLSKLA
RLVDVYARRPQVQERLTSQVADALMRILEPRGAIVVIECEHMCMSMRGIRKPGAKTLTSA
VRGQLRDPATRNEAMSLIIGR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatccggtgacgctcgacggtgagcagcccgtccgcgagttcgaccagaagcgg
gccgagaacgccgtccgtgagctgctgatcgcggtcggggaggacccggaccgcgagggc
ctgctggagacgccggcccgggtcgcccgcgcctaccgggagatattcgccggcctgtgg
cagcggccggaggacgtgctgaccaccaccttcgacctcggccacgacgagatggtgctg
gtcaaggacatcgaggtgttctccacctgcgagcaccacctggtgccgttccgcggcgtc
gcgcacgtcggctacatcccgtccgccagcggcaagatcaccggcctgtccaagctggcc
cggctggtcgacgtgtacgcccgccgcccgcaggtgcaggagcggctgaccagccaggtc
gcggacgcgctgatgcggatcctggagccgcgcggcgcgatcgtggtgatcgagtgcgag
cacatgtgcatgtcgatgcgcggcatccgcaagcccggggccaagaccctcacctccgcc
gtccgcggccagctgcgcgacccggccacccggaacgaggcgatgagtctcatcatcggc
cgctag

DBGET integrated database retrieval system