KEGG   Kitasatospora setae: KSE_43890Help
Entry
KSE_43890         CDS       T01648                                 

Gene name
folK
Definition
putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ksk  Kitasatospora setae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KSE_43890 (folK)
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     KSE_43890 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4854081..4854680
Genome map
AA seq 199 aa AA seqDB search
MATTDPTATPTTFDLQGRVDRVESTLHDSRTAAVALGSNLGNRLETLQGAVDALEDTPGV
RVTALSAVYETDAVGGPENQPSYFNAVAVLRTSLPPRDLLERANAVEDAFGRVREVRWGP
RTLDVDVLAYEGVTSDDPQLTLPHPRAHERAFVLAPWQDADPAAEVPGHGPVAALLAGLG
GPAAQGVRLRDDLRLRLPE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttggccacgaccgacccgaccgccacgccgaccacgttcgacctgcagggcagggtggac
cgcgtggagtccaccctgcacgactcccgcaccgccgccgtcgccctcggcagcaacctg
ggcaaccgcctggagaccctccagggcgccgtcgacgccctggaggacaccccgggggtg
cgggtgaccgcgctgtccgccgtgtacgagaccgacgccgtcggcggcccggagaaccag
ccgagctacttcaacgccgtcgcggtgctgcgcacctcgctgccgccgcgcgacctgctg
gagcgggccaacgcggtcgaggacgccttcggccgggtccgcgaggtccgctgggggccg
cgcaccctggacgtcgacgtgctcgcctacgagggcgtcaccagcgacgacccgcagctg
acgctgccccacccgcgcgcccacgagcgggcgttcgtgctcgccccctggcaggacgcc
gacccggccgccgaggtgcccgggcacgggccggtcgccgcgctcctggcgggcctcggc
gggcccgcggcgcagggcgtgcggctccgggacgacctgcggctgcgactgcccgagtga

DBGET integrated database retrieval system