KEGG   Kitasatospora setae: KSE_44080Help
Entry
KSE_44080         CDS       T01648                                 

Gene name
thrC2
Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ksk  Kitasatospora setae
Pathway
ksk00260  Glycine, serine and threonine metabolism
ksk00750  Vitamin B6 metabolism
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01230  Biosynthesis of amino acids
Module
ksk_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_44080 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KSE_44080 (thrC2)
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KSE_44080 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAJ30191
NITE: KSE_44080
UniProt: E4NFB1
Position
4873173..4874453
Genome map
AA seq 426 aa AA seqDB search
MAVDTAASTTVDLGPATALSCRECGTRFPLGPSFACLECFGPLEIAYDYAGYDAEELRKR
IEAGPASIWRYAPLLPVPADVAGKPNLNPGWTPLVKADNLGRELGFTGQLYVKDDSGNPT
HSFKDRVVACAIEAARAFDFTTLSCSSTGNLAGAVGAAAARAGFKSCVFIPHDLEQGKVV
MAGVYGGELVGIDGNYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYGEGSKTLAFEICEQ
LGWRLPDQIVIPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQAEGCSPVSAAFKAG
RDVIKPVKPDTIAKSLAIGNPADGPYVLDIARRTGGAVEDVTDAEVVEAIKLLARTEGVF
AETAGGVTVGVLKKLVETGQLDPSKETVAINTGDGLKTLDAVADAGMTAVIRPTLESFRA
AGLATA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgacaccgccgcatccaccaccgtcgacctcggtcccgcgaccgcgctgtcc
tgtcgcgagtgcggtacccgcttcccgctcggtccgagcttcgcctgtctggagtgtttc
ggcccgctggagatcgcctacgactacgcgggctacgacgccgaggagctgcgcaagcgg
atcgaggccggcccggcgtcgatctggcgctacgccccgctgctgcccgtccccgccgac
gtggccggcaagccgaacctgaacccgggctggaccccgctggtcaaggccgacaacctg
ggccgcgagctgggcttcaccggccagctgtacgtcaaggacgactcgggcaacccgacc
cactccttcaaggaccgggtggtggcctgcgcgatcgaggccgcccgcgccttcgacttc
accacgctctcctgctcctccaccggcaacctggccggcgcggtgggcgccgcggccgcc
cgggccggcttcaagtcctgcgtgttcatcccgcacgacctggagcagggcaaggtcgtg
atggccggcgtgtacggcggcgagctggtcggcatcgacggcaactacgacgacgtgaac
cgcttctgctccgagctgatcggcgacccggccggcgagggctggggcttcgtgaacgtc
aacctgcgcccgtactacggcgagggctcgaagaccctggcgttcgagatctgcgagcag
ctcggctggcggctgcccgaccagatcgtcatcccgatcgcctccggctcccagctcacc
aagatcgacaagggcctgcaggagctgatcaagctcggcctggtcgaggacaagccgtac
aagatcttcggcgcccaggccgagggctgctccccggtctccgccgccttcaaggccggc
cgcgacgtgatcaagccggtcaagccggacaccatcgccaagtcgctggcgatcggcaac
ccggccgacggcccgtacgtgctggacatcgcccgccgcaccggcggcgccgtcgaggac
gtcaccgacgccgaggtggtcgaggcgatcaagctgctcgcccgcaccgagggcgtcttc
gccgagaccgcgggcggcgtgaccgtcggcgtgctgaagaagctggtcgagacgggccag
ctggacccgtccaaggagaccgtcgcgatcaacaccggcgacggcctgaagaccctcgac
gcggtcgccgacgccggcatgaccgccgtgatccgcccgacgctggagtccttccgcgcc
gccggcctcgccaccgcctga

DBGET integrated database retrieval system