KEGG   Kitasatospora setae: KSE_44080Help
Entry
KSE_44080         CDS       T01648                                 

Gene name
thrC2
Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ksk  Kitasatospora setae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KSE_44080 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_44080 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KSE_44080 (thrC2)
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KSE_44080 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4873173..4874453
Genome map
AA seq 426 aa AA seqDB search
MAVDTAASTTVDLGPATALSCRECGTRFPLGPSFACLECFGPLEIAYDYAGYDAEELRKR
IEAGPASIWRYAPLLPVPADVAGKPNLNPGWTPLVKADNLGRELGFTGQLYVKDDSGNPT
HSFKDRVVACAIEAARAFDFTTLSCSSTGNLAGAVGAAAARAGFKSCVFIPHDLEQGKVV
MAGVYGGELVGIDGNYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYGEGSKTLAFEICEQ
LGWRLPDQIVIPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQAEGCSPVSAAFKAG
RDVIKPVKPDTIAKSLAIGNPADGPYVLDIARRTGGAVEDVTDAEVVEAIKLLARTEGVF
AETAGGVTVGVLKKLVETGQLDPSKETVAINTGDGLKTLDAVADAGMTAVIRPTLESFRA
AGLATA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgacaccgccgcatccaccaccgtcgacctcggtcccgcgaccgcgctgtcc
tgtcgcgagtgcggtacccgcttcccgctcggtccgagcttcgcctgtctggagtgtttc
ggcccgctggagatcgcctacgactacgcgggctacgacgccgaggagctgcgcaagcgg
atcgaggccggcccggcgtcgatctggcgctacgccccgctgctgcccgtccccgccgac
gtggccggcaagccgaacctgaacccgggctggaccccgctggtcaaggccgacaacctg
ggccgcgagctgggcttcaccggccagctgtacgtcaaggacgactcgggcaacccgacc
cactccttcaaggaccgggtggtggcctgcgcgatcgaggccgcccgcgccttcgacttc
accacgctctcctgctcctccaccggcaacctggccggcgcggtgggcgccgcggccgcc
cgggccggcttcaagtcctgcgtgttcatcccgcacgacctggagcagggcaaggtcgtg
atggccggcgtgtacggcggcgagctggtcggcatcgacggcaactacgacgacgtgaac
cgcttctgctccgagctgatcggcgacccggccggcgagggctggggcttcgtgaacgtc
aacctgcgcccgtactacggcgagggctcgaagaccctggcgttcgagatctgcgagcag
ctcggctggcggctgcccgaccagatcgtcatcccgatcgcctccggctcccagctcacc
aagatcgacaagggcctgcaggagctgatcaagctcggcctggtcgaggacaagccgtac
aagatcttcggcgcccaggccgagggctgctccccggtctccgccgccttcaaggccggc
cgcgacgtgatcaagccggtcaagccggacaccatcgccaagtcgctggcgatcggcaac
ccggccgacggcccgtacgtgctggacatcgcccgccgcaccggcggcgccgtcgaggac
gtcaccgacgccgaggtggtcgaggcgatcaagctgctcgcccgcaccgagggcgtcttc
gccgagaccgcgggcggcgtgaccgtcggcgtgctgaagaagctggtcgagacgggccag
ctggacccgtccaaggagaccgtcgcgatcaacaccggcgacggcctgaagaccctcgac
gcggtcgccgacgccggcatgaccgccgtgatccgcccgacgctggagtccttccgcgcc
gccggcctcgccaccgcctga

DBGET integrated database retrieval system