KEGG   Kitasatospora setae: KSE_44080Help
Entry
KSE_44080         CDS       T01648                                 

Gene name
thrC2
Definition
(RefSeq) putative threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ksk  Kitasatospora setae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KSE_44080 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_44080 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KSE_44080 (thrC2)
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KSE_44080 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4873173..4874453
Genome map
AA seq 426 aa AA seqDB search
MAVDTAASTTVDLGPATALSCRECGTRFPLGPSFACLECFGPLEIAYDYAGYDAEELRKR
IEAGPASIWRYAPLLPVPADVAGKPNLNPGWTPLVKADNLGRELGFTGQLYVKDDSGNPT
HSFKDRVVACAIEAARAFDFTTLSCSSTGNLAGAVGAAAARAGFKSCVFIPHDLEQGKVV
MAGVYGGELVGIDGNYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYGEGSKTLAFEICEQ
LGWRLPDQIVIPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQAEGCSPVSAAFKAG
RDVIKPVKPDTIAKSLAIGNPADGPYVLDIARRTGGAVEDVTDAEVVEAIKLLARTEGVF
AETAGGVTVGVLKKLVETGQLDPSKETVAINTGDGLKTLDAVADAGMTAVIRPTLESFRA
AGLATA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgacaccgccgcatccaccaccgtcgacctcggtcccgcgaccgcgctgtcc
tgtcgcgagtgcggtacccgcttcccgctcggtccgagcttcgcctgtctggagtgtttc
ggcccgctggagatcgcctacgactacgcgggctacgacgccgaggagctgcgcaagcgg
atcgaggccggcccggcgtcgatctggcgctacgccccgctgctgcccgtccccgccgac
gtggccggcaagccgaacctgaacccgggctggaccccgctggtcaaggccgacaacctg
ggccgcgagctgggcttcaccggccagctgtacgtcaaggacgactcgggcaacccgacc
cactccttcaaggaccgggtggtggcctgcgcgatcgaggccgcccgcgccttcgacttc
accacgctctcctgctcctccaccggcaacctggccggcgcggtgggcgccgcggccgcc
cgggccggcttcaagtcctgcgtgttcatcccgcacgacctggagcagggcaaggtcgtg
atggccggcgtgtacggcggcgagctggtcggcatcgacggcaactacgacgacgtgaac
cgcttctgctccgagctgatcggcgacccggccggcgagggctggggcttcgtgaacgtc
aacctgcgcccgtactacggcgagggctcgaagaccctggcgttcgagatctgcgagcag
ctcggctggcggctgcccgaccagatcgtcatcccgatcgcctccggctcccagctcacc
aagatcgacaagggcctgcaggagctgatcaagctcggcctggtcgaggacaagccgtac
aagatcttcggcgcccaggccgagggctgctccccggtctccgccgccttcaaggccggc
cgcgacgtgatcaagccggtcaagccggacaccatcgccaagtcgctggcgatcggcaac
ccggccgacggcccgtacgtgctggacatcgcccgccgcaccggcggcgccgtcgaggac
gtcaccgacgccgaggtggtcgaggcgatcaagctgctcgcccgcaccgagggcgtcttc
gccgagaccgcgggcggcgtgaccgtcggcgtgctgaagaagctggtcgagacgggccag
ctggacccgtccaaggagaccgtcgcgatcaacaccggcgacggcctgaagaccctcgac
gcggtcgccgacgccggcatgaccgccgtgatccgcccgacgctggagtccttccgcgcc
gccggcctcgccaccgcctga

DBGET integrated database retrieval system