KEGG   Kitasatospora setae: KSE_44560Help
Entry
KSE_44560         CDS       T01648                                 

Definition
putative beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ksk  Kitasatospora setae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KSE_44560
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KSE_44560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4923656..4925422)
Genome map
AA seq 588 aa AA seqDB search
MLTYDSTGFRLDGRPLRVLSGAVHYFRSRPEQWADRLAAVRAMGLNTVETYVPWNLHEPA
PGRFARVGELGAFLDEARRQGLWTIVRPGPYICAEWDNGGLPGWLTARLGRRVRTGDPEF
LAAVGAFFDVLLPQVVERQWGRPDGSVLMVQVENEYGAFGSDAGYLAALARGLRERGVSV
PLFTSDGPEDHMLAAGTVPGVLATVNFGSDPERGFAALRRHRPEDPPFCMEFWNGWFDQW
GRPHHTRGADDAADSLRRILAAGGSVNLYMAHGGTSFGTSAGANHADPPFNSTDWTHSPY
QPTVTSYDYDAPLDERGLPTAKFEAFRQVLAEFAAEHPDEARHLDGRTPELPSPAPVLAA
REVLLDEYAALPFGPAVESPVPPLFEELGLEHGLVRYTASVPALSPELPLTVEGLRDRAG
LRVDGRHVASLERGVAAEPVAAGGGARISLLVESLGRVNYGPLLGETKGVTGVRHERQYL
HGWRAEPLALDPLPAAAWGPGAPAPETLARGTLRLDAAGDAFLAVPEGGHGYLWVNGFLL
GRYDARGPQRTLYCPGPLLRPGPNSLVLLELGTAAPARIELRAAPELG
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgctcacctacgactcgaccggtttccgcctggacggccgcccgctgcgcgtcctgtcc
ggtgcggtgcactacttccgcagccgccccgagcagtgggccgaccggctcgcggcggtg
cgggcgatggggctgaacacggtcgagacctacgtgccgtggaacctgcacgagcccgcg
ccgggccggttcgcccgggtcggcgagctgggcgcgttcctggacgaggcccggcggcag
ggcctgtggacgatcgtccgccccggcccgtacatctgcgccgagtgggacaacggcggg
ctgcccggctggctcaccgcccggctggggcggcgggtgcgcaccggcgacccggagttc
ctggcggcggtgggggcgttcttcgacgtgctgctgccgcaggtggtggagcggcagtgg
gggcggccggacggcagcgtgctgatggtgcaggtggagaacgagtacggcgcgttcggc
agcgacgccggctacctggccgcgctggcccgggggctgcgcgagcgcggcgtgagcgtg
ccgctgttcacctcggacgggccggaggaccacatgctggcggccggcaccgtccccggg
gtgctggcgaccgtcaacttcggctccgacccggagcgcggcttcgccgcgctgcgccgc
caccgccccgaggacccgccgttctgcatggagttctggaacggctggttcgaccagtgg
ggccgcccgcaccacacccggggcgccgacgacgcggccgacagcctgcgccggatcctc
gcggcgggcggctcggtcaacctgtacatggcccacggcggcaccagcttcggcacctcc
gcgggcgccaaccacgccgacccgccgttcaactccaccgactggacgcactccccgtac
cagccgaccgtcacctcctacgactacgacgccccgctggacgaacgcggcctgcccacc
gccaagttcgaggcgttccggcaggtgctcgccgagttcgccgccgaacacccggacgag
gcacgccacctggacgggcgcactcccgaactcccctcccccgcgccggtgctggcggcc
cgcgaggtgctcctcgacgagtacgccgcgctgccgttcgggcccgccgtggagtcgccc
gtgccgccgctgttcgaggagctcgggctggagcacggcctggtccgctacaccgcctcg
gtgcccgcgctcagccccgaactgccgctcaccgtcgaggggttgcgcgaccgggccggc
ctgcgcgtcgacgggaggcacgtcgcctcgctggagcgcggggtcgccgccgaaccggtc
gcggccggcggcggggcccggatcagcctgctggtcgaatcgctcggccgggtcaactac
gggccgctgctcggcgagaccaagggcgtcaccggcgtccggcacgaacggcagtacctg
cacggctggcgggccgaaccgctcgccctcgacccgctgcccgcggccgcctggggcccg
ggcgccccggcgcccgagacgctggcccgcggcaccctgcggctggacgccgccggcgac
gccttcctcgccgtccccgagggcgggcacggctacctctgggtgaacggcttcctgctc
ggccgctacgacgcgcgcggcccgcagcgcaccctgtactgtcccggtccgctgctccgc
ccgggccccaactccctcgtcctgctggagctcggcaccgccgcaccggcccggatcgag
ctccgcgccgctcccgaactcggctga

DBGET integrated database retrieval system