KEGG   Kitasatospora setae: KSE_45850Help
Entry
KSE_45850         CDS       T01648                                 

Gene name
galU1
Definition
putative UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ksk  Kitasatospora setae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KSE_45850 (galU1)
   00052 Galactose metabolism
    KSE_45850 (galU1)
   00500 Starch and sucrose metabolism
    KSE_45850 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_45850 (galU1)
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KSE_45850 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5071164..5072084
Genome map
AA seq 306 aa AA seqDB search
MTNKHARQPVTKAVVPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEASAAGLSDIL
MVTGRNKRALEDHFDRAYELEELLSRKGDQERLRRVQESVQLASMHYVRQGDPKGLGHAV
SVAEQHVAGQPFAVLLGDDLIDPRDPLLSRMIEVQQELGGSVVALMEVDPAQIHLYGCAA
VKATGIGEDVFQVTDLVEKPDTADAPSNYAVIGRYVLDPAVFDVLRETPPGRGGEIQLTD
ALRELATRDESNGGPVHGVLFKGRRYDTGDRADYLRAIVRLAAERDDLGPEFRSWLRQFV
ATEMQG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaagcacgcccgccagccggtcaccaaggcagtcgttccggctgccggcctc
ggcacccggttcctccccgccacgaaggccacgcccaaggagatgctcccggtcgtcgac
aagccggccatccagtacgtcgtcgaggaggcctcggccgccggcctctccgacatactg
atggtgaccggccgcaacaagcgtgccctggaggaccacttcgaccgggcctacgagctg
gaggagctgctcagccgcaagggcgaccaggagcggctgcgccgggtccaggagtcggtc
cagctggccagcatgcactacgtccggcagggcgaccccaagggcctcggccacgccgtc
tcggtcgccgaacagcacgtcgccggccagccgttcgccgtcctgctgggtgacgacctg
atcgacccgcgcgacccgctgctctcccggatgatcgaggtgcagcaggaactcggcggc
tccgtcgtcgcgttgatggaggtcgaccccgcgcagatccacctgtacggctgcgccgcc
gtcaaggccaccggcatcggcgaggacgtcttccaggtcaccgacctggtcgagaagccc
gacaccgccgacgccccctccaactacgcggtcatcggccggtacgtcctcgacccggcg
gtcttcgacgtgctgcgcgagaccccgcccggccgcggcggcgagatccagctgaccgac
gcgctgcgcgagctggccacccgcgacgagtccaacggcggcccggtgcacggcgtgctg
ttcaagggccgccgctacgacaccggcgaccgcgccgactacctccgggcgatcgtccgg
ctggccgccgagcgcgacgacctcggccccgagttccgcagctggctgcggcagttcgtc
gccaccgagatgcagggctga

DBGET integrated database retrieval system