KEGG   Kitasatospora setae: KSE_45910Help
Entry
KSE_45910         CDS       T01648                                 

Gene name
glsA
Definition
putative glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ksk  Kitasatospora setae
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ksk00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ksk00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ksk00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5076511..5077542)
Genome map
AA seq 343 aa AA seqDB search
MESVIHDAEDIVDPKAAQAAVSTGRLPSDEAVRAALSRVHRRFRDDRGGKVADYIPVLAE
ADPELFGIALAHVGGSLHAVGDAEHLFSIQSVSKAFVFALVDQELGHHTVRRRIGVNSTG
LPFDSVLAVELNHGSPMNPMVNAGALATAALAPGDSPEERWEFVRRGLSRFAGRELRLDQ
RVYASEAATNQRNESIARLLDSYGVLARDPATTTDLYTRQCSLAVCVRDLAVMGATLANG
GVNPLTGDRVVSPGVCRDTLAALATSGLYERSGDWLYEVGMPGKSGVSGGIVTVAPGKGS
IAAFSPRLDPAGNSVRGQRVTHYLSGALGLDLFASTPHPGSGG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttggagagcgtgatccacgacgccgaggacatcgtcgacccgaaggcggcccaggccgcc
gtctcgaccgggcggctcccctcggacgaggccgtccgggcggcactgtcccgggtgcac
cggcgcttccgggacgaccgcggcgggaaggtcgccgactacatccccgtgctggccgag
gccgatccggagctgttcggcatcgcgctggcccacgtcggcggcagcctgcacgcggtc
ggcgacgcggagcacctgttctcgatccagtcggtctcgaaggccttcgtgttcgccctg
gtcgaccaggagctcgggcaccacaccgtccgccgccggatcggcgtcaacagcaccggc
ctgccgttcgactcggtgctggccgtcgagctcaaccacggcagcccgatgaacccgatg
gtcaacgccggggcgctggccaccgccgccctggccccgggcgacagccccgaggagcgc
tgggagttcgtccgccgcggcctgtcccgcttcgccggccgcgaactgcggctggaccaa
agggtgtacgcctccgaggcggccaccaaccagcgcaacgagtcgatcgcccgcctgctg
gacagctacggcgtcctggcccgcgacccggccaccaccaccgacctgtacacccggcag
tgctcgctggcggtctgcgtccgcgacctcgcggtgatgggcgccaccctggccaacggc
ggcgtcaacccgctcaccggcgaccgggtggtcagccccggggtctgccgcgacaccctc
gccgcgctggccacctccggcctctacgagcgcagcggcgactggctgtacgaggtcggc
atgccgggcaagagcggcgtctccggcggcatcgtcaccgtcgccccgggcaagggctcc
atcgcggccttctccccccgcctcgacccggccggcaacagcgtgcgcggccagcgcgtc
acccactacctgtccggggccctcggcctcgacctcttcgcctccaccccccacccgggc
agcggcgggtga

DBGET integrated database retrieval system