KEGG   Kitasatospora setae: KSE_46270Help
Entry
KSE_46270         CDS       T01648                                 

Gene name
ispE
Definition
(GenBank) putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ksk  Kitasatospora setae
Pathway
ksk00900  Terpenoid backbone biosynthesis
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01130  Biosynthesis of antibiotics
Module
ksk_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KSE_46270 (ispE)
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     KSE_46270 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAJ30408
NITE: KSE_46270
UniProt: E4NFX8
Position
5117797..5118723
Genome map
AA seq 308 aa AA seqDB search
MVTVRVPAKVNVQLGVGGVRPDGYHDLANVFFAVALGDQVTATPGTGVTLSCDGPDAAAV
PLDDSNLAARAARLLAARHGLAEPGVHLHIDKAIPVAGGMAGGSADGAAALLACDALWGL
DTPLPVLLELAAELGSDVPFALLGGVALGRGRGELLEPLPVAGTFHWVFAVADGGLSTPA
VFRECDRLREESGLGSSIDQVPTPDADPALLAALADGDPVALAAALANDLQAAAVSLRPS
LADTLHAGTEAGALAALVSGSGPTCAFLAKDADAAAHIAAALRASGTCRTAHPTHGPVPG
ARVVHTSA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtcacggtccgggtccccgccaaggtcaacgtgcagctcggcgtcggcggggtccgc
cccgacggctaccacgacctggcgaacgtcttcttcgccgtcgccctcggcgaccaggtc
accgccacccccggcacgggcgtcacgctcagctgcgacggccccgacgccgccgccgtc
ccgctcgacgacagcaacctggccgcccgcgccgcccggctgctcgccgcccgccacggc
ctcgccgaacccggcgtgcacctgcacatcgacaaggccatcccggtggccggcgggatg
gccggcggcagcgcggacggcgccgccgcgctgctcgcctgcgacgcgctgtggggcctg
gacaccccgctgcccgtcctgctggaactggccgccgaactcggctccgacgtcccgttc
gcgctgctcggcggcgtcgcgctgggccgcggccggggcgagctgctggagccgctgccg
gtcgccgggacgttccactgggtgttcgcggtcgccgacggcggcctctccaccccggcg
gtcttccgcgagtgcgaccggctgcgcgaggagtccggcctcggctcctcgatcgaccag
gtccccacccccgacgccgacccggcgctgctcgccgccctcgccgacggcgaccccgtc
gcgctggccgccgccctcgccaacgacctccaggccgccgccgtctcgctgcgcccctcc
ctcgccgacaccctgcacgccggcaccgaggcgggcgcgctggccgccctggtctccggc
tccggcccgacctgcgccttcctcgccaaggacgccgacgccgccgcccacatcgccgcc
gccctccgcgcctccggcacctgccgcaccgcccaccccacccacggcccggtcccgggc
gcccgggtggtccacacctctgcttga

DBGET integrated database retrieval system