KEGG   Kitasatospora setae: KSE_46270Help
Entry
KSE_46270         CDS       T01648                                 

Gene name
ispE
Definition
putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ksk  Kitasatospora setae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ksk00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5117797..5118723
Genome map
AA seq 308 aa AA seqDB search
MVTVRVPAKVNVQLGVGGVRPDGYHDLANVFFAVALGDQVTATPGTGVTLSCDGPDAAAV
PLDDSNLAARAARLLAARHGLAEPGVHLHIDKAIPVAGGMAGGSADGAAALLACDALWGL
DTPLPVLLELAAELGSDVPFALLGGVALGRGRGELLEPLPVAGTFHWVFAVADGGLSTPA
VFRECDRLREESGLGSSIDQVPTPDADPALLAALADGDPVALAAALANDLQAAAVSLRPS
LADTLHAGTEAGALAALVSGSGPTCAFLAKDADAAAHIAAALRASGTCRTAHPTHGPVPG
ARVVHTSA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtcacggtccgggtccccgccaaggtcaacgtgcagctcggcgtcggcggggtccgc
cccgacggctaccacgacctggcgaacgtcttcttcgccgtcgccctcggcgaccaggtc
accgccacccccggcacgggcgtcacgctcagctgcgacggccccgacgccgccgccgtc
ccgctcgacgacagcaacctggccgcccgcgccgcccggctgctcgccgcccgccacggc
ctcgccgaacccggcgtgcacctgcacatcgacaaggccatcccggtggccggcgggatg
gccggcggcagcgcggacggcgccgccgcgctgctcgcctgcgacgcgctgtggggcctg
gacaccccgctgcccgtcctgctggaactggccgccgaactcggctccgacgtcccgttc
gcgctgctcggcggcgtcgcgctgggccgcggccggggcgagctgctggagccgctgccg
gtcgccgggacgttccactgggtgttcgcggtcgccgacggcggcctctccaccccggcg
gtcttccgcgagtgcgaccggctgcgcgaggagtccggcctcggctcctcgatcgaccag
gtccccacccccgacgccgacccggcgctgctcgccgccctcgccgacggcgaccccgtc
gcgctggccgccgccctcgccaacgacctccaggccgccgccgtctcgctgcgcccctcc
ctcgccgacaccctgcacgccggcaccgaggcgggcgcgctggccgccctggtctccggc
tccggcccgacctgcgccttcctcgccaaggacgccgacgccgccgcccacatcgccgcc
gccctccgcgcctccggcacctgccgcaccgcccaccccacccacggcccggtcccgggc
gcccgggtggtccacacctctgcttga

DBGET integrated database retrieval system