KEGG   Kitasatospora setae: KSE_46390Help
Entry
KSE_46390         CDS       T01648                                 

Definition
putative fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ksk  Kitasatospora setae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    KSE_46390
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    KSE_46390
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     KSE_46390
Lipid biosynthesis proteins [BR:ksk01004]
 Desaturase
  First
   KSE_46390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5131586..5132572)
Genome map
AA seq 328 aa AA seqDB search
MTIQAGQAPPRAAEDARTAEDARTATTLSATRGGERQGALERATLGLFIALPFAALLAAV
PLAWGRGLSWLDAGLAVGMYFLTCHGITVGYHRYFTHGAFKANRPLRLALAVAGSMAVEG
PLVRWVADHRKHHRYSDKDGDPHSPWRYGENLPALLKGLWWAHTGWLFDEEQTPQLTYAP
DLVRDPAIRAVSRLFWLWTLLSLALPPLVGGLATWSWQGALSAFFWGSLVRVALLHHVTW
SINSICHAVGSRPFRSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVLRGQVDSSAR
VIRWFERAGWARDVRWPGAERIAARRAA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccaggccgggcaggcgccgccgcgcgccgccgaggacgcccgcaccgccgag
gacgcccgcaccgccaccacgctctccgccaccaggggcggcgagagacagggcgcgctg
gagcgcgccaccctgggcctgttcatcgccctgccgttcgcggcgctgctcgccgccgtc
ccgctggcctggggccgcgggctgtcctggctggacgccggcctcgcggtcggcatgtac
ttcctcacctgccacggcatcaccgtcggctaccaccgctacttcacccacggcgccttc
aaggccaaccggccgctgcggctggccctggcggtggccggctcgatggccgtcgagggc
ccgctggtgcgctgggtcgccgaccaccgcaagcaccaccgctactccgacaaggacggc
gacccgcactcgccgtggcgctacggcgagaacctgccggccctgctcaagggcctgtgg
tgggcgcacacgggctggctgttcgacgaggagcagaccccgcagctcacctacgcgccc
gacctggtccgcgacccggcgataagggcggtctcccggctgttctggctctggacgctg
ctctcgctggccctgccgccgctggtcggcggcctggccacctggagctggcagggcgcg
ctgtccgccttcttctggggctcgctggtccgggtcgcgctgctgcaccacgtcacctgg
tcgatcaactcgatctgccacgcggtgggttcgcgcccgttccggtcccgcgaccggtcc
ggcaacgtgtggtggctggcggtgctgtcctgcggcgagtcctggcacaacctgcaccac
gccgaccccacctcggcccggcacggcgtgctccgcggccaggtcgactcctccgcccgg
gtcatccgctggttcgagcgggcgggctgggcgcgcgacgtccgctggcccggcgcggag
cggatcgccgcccgccgcgccgcatga

DBGET integrated database retrieval system