KEGG   Kitasatospora setae: KSE_47050Help
Entry
KSE_47050         CDS       T01648                                 

Definition
putative protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ksk  Kitasatospora setae
Brite
Enzymes [BR:ksk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     KSE_47050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5205351..5206493)
Genome map
AA seq 380 aa AA seqDB search
MTTTAPTAWQQAADALVQDLRGKGAVRTDAVARALREVPRHLFVSGHYGPGGFTAVDPEQ
PTPETLAIVYSDRGLTTHVPDDTSGTSSSTSQPSIVAKMLEAADLHPGMDVLEIGAGTGW
NSALIAHITGGPVTAVEHSEPVATEARAALERAAVPGVRVHTGDGYLGYPSNGYFDRIIV
TCGIAGIPPAWLDQLTPNGMILAPLAHGGVHPLTRVYAPGPGGTPTGRLVTMADFMTAAG
PLYGGRPVPPSSRGSYLPVPAGRVAGPFPGGLDRDAFADLCMFLAGHDPRVTCAASEDGT
YGGCAVVTEDETAGVFVQPDGLYSAGSDAETAALVRTTADRAAAWDVSGRPPLIAWSCSM
QLAGPSSDPLLVPGRWHIAE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccaccgccccgaccgcctggcagcaggccgccgacgctctcgtgcaggatctg
cgcggcaagggcgccgtccgcaccgatgccgtcgcccgcgcccttcgagaagtcccccgg
cacctgttcgtctccggccactacgggcccggcggcttcaccgccgtcgaccccgagcag
cccaccccggagaccctggcgatcgtctactccgaccgcggcctgaccacccacgtgccc
gacgacacctcgggcacctcctcctcgacgtcgcagccgtcgatcgtggcgaagatgctg
gaggccgccgacctgcaccccgggatggacgtgctggagatcggcgcgggaacgggctgg
aacagcgcgctgatcgcgcacatcaccggcggcccggtgaccgccgtcgagcactcggaa
ccggtcgccaccgaggcccgcgccgcgctggagcgggcggccgtcccgggggtccgcgtc
cacaccggggacggctatctcgggtaccccagcaacggctacttcgaccggatcatcgtc
acgtgcggcatcgcgggcatccccccggcgtggctcgaccagctcaccccgaacggcatg
atcctcgcaccgctcgcgcacgggggcgtgcacccgctgacgcgggtctacgcccccggg
ccgggcggcaccccgaccgggcgcctggtcacgatggccgacttcatgaccgccgccggc
cccttgtacggcggccgacccgtgccgccgtcctcccggggctcgtacctgccggtgccc
gccggccgggtcgccgggccgttccccggcggcctggaccgggacgccttcgccgacctg
tgcatgttcctggccgggcacgacccccgggtcacctgcgccgcctccgaggacggcacg
tacggcgggtgcgccgtcgtcaccgaggacgagacggccggggtgttcgtccagccggac
ggcctctactcggccgggagcgacgccgagaccgccgcgctcgtccggaccaccgcggac
cgtgcggcggcctgggacgtgagcgggcggccgcccctcatcgcctggtcctgcagcatg
cagctggccggtccctcctctgacccgctgctggtgcccggccggtggcacatcgccgag
tga

DBGET integrated database retrieval system