KEGG   Kitasatospora setae: KSE_48480Help
Entry
KSE_48480         CDS       T01648                                 

Gene name
folP2
Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ksk  Kitasatospora setae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KSE_48480 (folP2)
Enzymes [BR:ksk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     KSE_48480 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5358565..5359428)
Genome map
AA seq 287 aa AA seqDB search
MALRLGTREFGPDELVVMAIVNRTPDSFFDRGATFADEAAFAAADRAVAEGAAILDIGGV
KAGPGEEVGVEEELRRTVPFVAELRERHPDVVISVDTWRHEVGEAVCAVGADLLNDAWGG
FDPKLAEVAAKYGAGLVCTHAGGAEPRTRPHRVGYEDVMADILAVTVGLAERALELGVRR
DGLIIDPGHDFGKNTRHSLEATRRLPEMTATGFPVLVSLSNKDFVGETLDRPVDERLLGT
LATTAVSAWLGARIYRAHQVAETRQVLDMVASIRGTRPPAVARRGLA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtggcactacgcctcggcacacgggagttcggcccggacgagctggtcgtcatggccatc
gtcaaccgcactccggactcgttcttcgaccgcggggcgaccttcgccgacgaggccgcg
ttcgcggccgcggaccgggcggtcgccgagggcgcggcgatcctggacatcggcggggtg
aaggccggtccgggcgaggaggtcggcgtggaggaggagttgcgccgcacggtgccgttc
gtcgccgagctgcgcgagcgccacccggacgtggtgatcagcgtcgacacctggcggcac
gaggtcggcgaggcggtctgcgcggtcggcgccgacctgctgaacgacgcctggggcggc
ttcgacccgaagctcgccgaggtcgcggccaagtacggcgcgggcctggtgtgcacgcac
gcgggcggcgccgagccgcgcacccgcccgcaccgggtggggtacgaggacgtgatggcg
gacatcctggcggtgaccgtcggcctggccgagcgggcgctcgaactgggcgtgcgccgc
gacgggctgatcatcgacccggggcacgacttcgggaagaacacccggcactcgctggag
gcgacccgccggctgccggagatgacggcgaccggcttcccggtgctggtctcgctctcc
aacaaggacttcgtcggcgagaccctggaccggccggtggacgagcggctgctcggcacc
ctggccaccacggcggtctcggcctggctgggcgcgcggatctaccgggcgcaccaggtc
gccgagacccgccaggtgctggacatggtggcgtcgatccgcggcacccggcccccggcg
gtggcccgccgggggctggcctga

DBGET integrated database retrieval system