KEGG   Kitasatospora setae: KSE_48480Help
Entry
KSE_48480         CDS       T01648                                 

Gene name
folP2
Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ksk  Kitasatospora setae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ksk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5358565..5359428)
Genome map
AA seq 287 aa AA seqDB search
MALRLGTREFGPDELVVMAIVNRTPDSFFDRGATFADEAAFAAADRAVAEGAAILDIGGV
KAGPGEEVGVEEELRRTVPFVAELRERHPDVVISVDTWRHEVGEAVCAVGADLLNDAWGG
FDPKLAEVAAKYGAGLVCTHAGGAEPRTRPHRVGYEDVMADILAVTVGLAERALELGVRR
DGLIIDPGHDFGKNTRHSLEATRRLPEMTATGFPVLVSLSNKDFVGETLDRPVDERLLGT
LATTAVSAWLGARIYRAHQVAETRQVLDMVASIRGTRPPAVARRGLA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtggcactacgcctcggcacacgggagttcggcccggacgagctggtcgtcatggccatc
gtcaaccgcactccggactcgttcttcgaccgcggggcgaccttcgccgacgaggccgcg
ttcgcggccgcggaccgggcggtcgccgagggcgcggcgatcctggacatcggcggggtg
aaggccggtccgggcgaggaggtcggcgtggaggaggagttgcgccgcacggtgccgttc
gtcgccgagctgcgcgagcgccacccggacgtggtgatcagcgtcgacacctggcggcac
gaggtcggcgaggcggtctgcgcggtcggcgccgacctgctgaacgacgcctggggcggc
ttcgacccgaagctcgccgaggtcgcggccaagtacggcgcgggcctggtgtgcacgcac
gcgggcggcgccgagccgcgcacccgcccgcaccgggtggggtacgaggacgtgatggcg
gacatcctggcggtgaccgtcggcctggccgagcgggcgctcgaactgggcgtgcgccgc
gacgggctgatcatcgacccggggcacgacttcgggaagaacacccggcactcgctggag
gcgacccgccggctgccggagatgacggcgaccggcttcccggtgctggtctcgctctcc
aacaaggacttcgtcggcgagaccctggaccggccggtggacgagcggctgctcggcacc
ctggccaccacggcggtctcggcctggctgggcgcgcggatctaccgggcgcaccaggtc
gccgagacccgccaggtgctggacatggtggcgtcgatccgcggcacccggcccccggcg
gtggcccgccgggggctggcctga

DBGET integrated database retrieval system