KEGG   Kitasatospora setae: KSE_49350Help
Entry
KSE_49350         CDS       T01648                                 

Definition
putative beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ksk  Kitasatospora setae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_49350
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    KSE_49350
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KSE_49350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5458327..5459901)
Genome map
AA seq 524 aa AA seqDB search
MPGTESADLLRDAGAVLQPGFAGLTAPEWLRRRLGDGELGGVALFGRNIRTPQQVAALTS
ELYALNGDLLVATDEEGGDVTRLEVVSGSSYPGNLALGEVDDTDLTERVARSIGFDLSSV
GVNLNYAPDADVNSNPDNPVIGVRSFGGDGDLAARHTAAYVRGLQSAGVAACAKHFPGHG
DTAGDSHLGLPRIDLALDQFAEHLLPFRAAIAAGVKSIMTAHILFDAYDAQLPATMSQRI
LTGLLREELGFDGLIVTDGIEMGAISGTHGVAAGSVRAIAAGADTICVGGGLHDEDAFVY
LRDALVWAVREGRLSADRLHEAAERNRAVARWSAGVRASQVGQQAEVGVGLTAARRALRI
TGELRPLGGVPHVVEFSPGANIAAGDETPWGVASPLGELVPGTTSSRVAPPATVTEGSGL
LHVEVAAEDAEIDTAPLLGAAVGRPLVLVVRDVHRHPWMRRAALALVEHRPDAVLVETGT
AHGVAELFAPSGVTTLATYGGSRVCAIAAAEALAGLAVTAAQAG
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtacggaaagcgccgatctcctccgcgacgccggagcggtcctgcagcccggc
ttcgccggtctgaccgcgcccgagtggctgcgtcgcagactgggcgacggcgagctcggc
ggcgtcgccctgttcggccgcaacatccgcaccccgcagcaggtcgccgcgctgacctcg
gagctgtacgcgctcaacggggacctgctggtcgccaccgacgaggagggcggcgacgtc
acccgcctcgaggtggtcagcggctcctcctacccgggcaacctggcgctcggtgaggtc
gacgacaccgacctcaccgagcgggtcgcccgctcgatcgggttcgacctgtccagcgtc
ggcgtgaacctgaactacgcgccggacgcggacgtcaactccaacccggacaacccggtg
atcggcgtccggtccttcggcggcgacggcgacctggccgcccggcacaccgcggcgtac
gtccgcggcctgcagtcggccggcgtggcggcctgcgccaagcacttccccggccacggc
gacacggccggcgactcgcacctcgggctgccgcggatcgacctcgcgctggaccagttc
gccgagcacctgctgccgttccgcgccgccatcgcggccggcgtgaagagcatcatgacg
gcgcacatcctgttcgacgcctacgacgcccagctccccgcgaccatgtcgcagcggatc
ctgaccggcctgctccgcgaggagctcggcttcgacgggctgatcgtcaccgacggcatc
gagatgggcgccatctccggcacccacggcgtcgcggccggctcggtgcgggccatcgcg
gccggcgccgacaccatctgcgtcggcggcggcctgcacgacgaggacgccttcgtctac
ctgcgcgacgcgctggtctgggcggtccgcgagggccggctgtcggccgaccgcctgcac
gaggcggccgagcgcaaccgggccgtggcccgctggtcggccggtgtccgggcctcccag
gtcgggcagcaggccgaggtcggcgtcggcctgaccgccgcccgccgggcgctgcggatc
accggcgagctccgcccgctgggcggcgtcccgcacgtggtggagttctccccgggcgcg
aacatcgcggccggcgacgagaccccgtggggcgtggcgagcccgctgggcgagctggtg
ccgggcaccacctccagccgggtcgcgccgcccgcgaccgtgaccgagggctccggcctg
ctgcacgtcgaggtggccgccgaggacgccgagatcgacaccgccccgctgctcggcgcg
gcggtcggccgtccgctggtgctggtggtgcgcgacgtgcaccggcacccgtggatgcgc
cgggccgcgctggccctggtcgagcaccggccggacgcggtgctggtggagaccggcacc
gcccacggggtcgccgagctgttcgccccgagcggggtgaccacgctggccacctacggc
gggtcgcgggtctgcgcgatcgcggccgcggaggccctcgcggggctcgcggtgacggcc
gcccaggccggctga

DBGET integrated database retrieval system