KEGG   Kitasatospora setae: KSE_50010Help
Entry
KSE_50010         CDS       T01648                                 

Gene name
thrC1
Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ksk  Kitasatospora setae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ksk01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ksk00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ksk00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5536436..5537533
Genome map
AA seq 365 aa AA seqDB search
MNAIAESTARGSHTHQWRGLIEEYRDRLPVSDSTPVVTLLEGGTPLVPAQVLSERTGCDV
YLKVEGANPTGSFKDRGMTMAISKAKEDGAQAVICASTGNTSASAAAYAVRAGMVSAVLV
PQGKIALGKMGQALVHGAKILQVDGNFDDCLTLARELSEKYPVALVNSVNPVRIEGQKTA
AFEIVDMLGDAPDLHVLPVGNAGNITAYWKGYREYAADGLATRTPRMWGFQASGSAPIVD
GAPVLKPQTIATAIRIGNPASWDYALAARDESGGLIDKVTDRQILAAYRLLAAQEGVFVE
PASAASVAGLLAKAEAGLVDPGQRIVCTVTGNGLKDPDWAVAGAPQPQVVPIDPEAAARR
LGLLD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccattgccgaaagcaccgcccgaggcagccacacccaccagtggcgcggcctc
atcgaggagtaccgcgaccgcctcccggtctccgactccacccccgtggtgaccctgctg
gagggcggcacgccgctcgtccccgcccaggtgctctccgagcgcaccggctgcgacgtc
tacctcaaggtcgagggcgccaacccgaccggctccttcaaggaccgcgggatgacgatg
gccatctccaaggccaaggaggacggcgcgcaggccgtcatctgcgcgtccaccggcaac
acctcggcctccgccgccgcctacgcggtgcgggccgggatggtctccgccgtgctcgtc
ccgcagggcaagatcgccctcggcaagatgggccaggcgctggtgcacggcgccaagatc
ctgcaggtcgacggcaacttcgacgactgcctgacgctggcccgcgagctctccgagaag
tacccggtggcgctggtcaactcggtcaacccggtccgcatcgagggccagaagaccgcc
gccttcgagatcgtcgacatgctcggcgacgcccccgacctgcacgtcctgccggtcggc
aacgcgggcaacatcaccgcctactggaagggctaccgcgagtacgcggcggacggcctg
gccacccgcaccccccggatgtggggcttccaggcgtccggctcggccccgatcgtggac
ggcgcgccggtgctcaagccgcagaccatcgccaccgcgatccggatcggcaacccggcc
tcctgggactacgcgctggccgcccgggacgagtccggcggcctgatcgacaaggtgacg
gaccgtcagatcctggccgcctaccgcctgttggccgcgcaggagggcgtcttcgtggag
cccgcctccgccgcctcggtggccggcctgctggccaaggccgaggccggcctggtcgac
cccggccagcggatcgtctgcaccgtcaccggcaacggcctcaaggacccggactgggcg
gtggccggcgcgccgcagccgcaggtcgtcccgatcgacccggaggcggccgcccgccgc
ctcgggctgctcgactga

DBGET integrated database retrieval system