KEGG   Kitasatospora setae: KSE_50010Help
Entry
KSE_50010         CDS       T01648                                 

Gene name
thrC1
Definition
(RefSeq) putative threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ksk  Kitasatospora setae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KSE_50010 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_50010 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KSE_50010 (thrC1)
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KSE_50010 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5536436..5537533
Genome map
AA seq 365 aa AA seqDB search
MNAIAESTARGSHTHQWRGLIEEYRDRLPVSDSTPVVTLLEGGTPLVPAQVLSERTGCDV
YLKVEGANPTGSFKDRGMTMAISKAKEDGAQAVICASTGNTSASAAAYAVRAGMVSAVLV
PQGKIALGKMGQALVHGAKILQVDGNFDDCLTLARELSEKYPVALVNSVNPVRIEGQKTA
AFEIVDMLGDAPDLHVLPVGNAGNITAYWKGYREYAADGLATRTPRMWGFQASGSAPIVD
GAPVLKPQTIATAIRIGNPASWDYALAARDESGGLIDKVTDRQILAAYRLLAAQEGVFVE
PASAASVAGLLAKAEAGLVDPGQRIVCTVTGNGLKDPDWAVAGAPQPQVVPIDPEAAARR
LGLLD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccattgccgaaagcaccgcccgaggcagccacacccaccagtggcgcggcctc
atcgaggagtaccgcgaccgcctcccggtctccgactccacccccgtggtgaccctgctg
gagggcggcacgccgctcgtccccgcccaggtgctctccgagcgcaccggctgcgacgtc
tacctcaaggtcgagggcgccaacccgaccggctccttcaaggaccgcgggatgacgatg
gccatctccaaggccaaggaggacggcgcgcaggccgtcatctgcgcgtccaccggcaac
acctcggcctccgccgccgcctacgcggtgcgggccgggatggtctccgccgtgctcgtc
ccgcagggcaagatcgccctcggcaagatgggccaggcgctggtgcacggcgccaagatc
ctgcaggtcgacggcaacttcgacgactgcctgacgctggcccgcgagctctccgagaag
tacccggtggcgctggtcaactcggtcaacccggtccgcatcgagggccagaagaccgcc
gccttcgagatcgtcgacatgctcggcgacgcccccgacctgcacgtcctgccggtcggc
aacgcgggcaacatcaccgcctactggaagggctaccgcgagtacgcggcggacggcctg
gccacccgcaccccccggatgtggggcttccaggcgtccggctcggccccgatcgtggac
ggcgcgccggtgctcaagccgcagaccatcgccaccgcgatccggatcggcaacccggcc
tcctgggactacgcgctggccgcccgggacgagtccggcggcctgatcgacaaggtgacg
gaccgtcagatcctggccgcctaccgcctgttggccgcgcaggagggcgtcttcgtggag
cccgcctccgccgcctcggtggccggcctgctggccaaggccgaggccggcctggtcgac
cccggccagcggatcgtctgcaccgtcaccggcaacggcctcaaggacccggactgggcg
gtggccggcgcgccgcagccgcaggtcgtcccgatcgacccggaggcggccgcccgccgc
ctcgggctgctcgactga

DBGET integrated database retrieval system