KEGG   Kitasatospora setae: KSE_50660Help
Entry
KSE_50660         CDS       T01648                                 

Gene name
glgB
Definition
putative 1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ksk  Kitasatospora setae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ksk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5607327..5609768)
Genome map
AA seq 813 aa AA seqDB search
MTPLGPLDPSADRQPAVPATFRSGPRSGAAGGRPAAKAPAKPAAKSTGKAAAKPAAKAAT
KAPAKAARSGAAAARPQAGGGALRLPEAPLPPAEVERLVSGAHHDPHGLLGAHEVPEGTA
VRVLRPFAERVVVETELGPAELTHQQDGLFTGLLTGQRFPRYTLRVAYPGGEPVVQEDGY
RFAPTLGELDLHLIREGRHEQLWTALGSHLRTVDGVAGTAFAVWAPNAVGVRVIGSFNHW
DGTAHPMRSLGSSGVWEVFLPGVGEGERYKYQILTRHGQRLEKADPLARAAQCPPDTASV
VTVSRHEWQDAEWMERRARAVHHRAPLSVYELHLASWRPELTTYREIAEVLPGYLTELGF
THVEFMPVMEHPFGGSWGYQVSGFYAPTARLGTPDDFRFLVDTLHRHGIGVLVDWVPAHF
PKDDFALARFDGEPLYEPADPLRAEHPDWGTLEFDYGRTEVRNFLVANAVYWCEEFHVDG
LRVDAVASMLYLDYSREGGAWTPNQYGGRENLDAASFLQEMNATVYRRCPGVLTVAEEST
AWDGVTRPTDSGGLGFGLKWNMGWMHDSLVYISKEPVHRRYHHDEITFSMVYAYSENYIL
PISHDEVVHGKRALVSKMPGDWWQQRANHRAYLGFMWAHPGKQLLFMGQEFAQGAEWDHE
SGPQWWVLDEGWPAHGDHRGVQRLVGDLNHVYRDTPALYEQDTVPAGFAWLDGGAAEDNV
LSFVRFAADGSPLVAVCNFSPVVRHGFRVGLPRLEGAEQLWEEALNTDAERYGGGGVANS
SPVKSEPEPWNAQPRSAELVLPPLATVWLRPAR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgctcggtccgctcgacccgtccgccgaccgccaaccggccgtcccggccacg
ttccgcagcggcccgcgcagcggggccgccggcgggcggcccgccgcgaaggcgcccgcc
aagccggcggcgaagtccaccggcaaggccgccgccaagcccgccgcgaaggctgcgacg
aaggctccggcgaaggccgcccggtccggtgcggcggcggcgcggccgcaggccggcggg
ggcgcgctgcggctgccggaggcgccgctgccgcccgccgaggtggagcggctggtctcc
ggcgcgcaccacgacccgcacgggctgctgggcgcgcacgaggtgcccgagggcaccgcg
gtccgggtgctgcggccgttcgcggagcgggtggtggtggagaccgagctgggcccggcc
gagctgacccaccagcaggacggcctgttcaccggcctgctgaccgggcagcgcttcccg
cgctacacgctgcgggtggcgtacccgggcggcgagccggtcgtccaggaggacggctac
cgcttcgcgccgacgctgggcgagctggacctgcacctgatccgggagggccggcacgag
cagctgtggacggcgctcggctcgcacctgcgcacggtcgacggggtggcgggcaccgcg
ttcgcggtgtgggcgccgaacgcggtcggggtgcgggtgatcggctcgttcaaccactgg
gacggcaccgcgcacccgatgcgctcgctgggctcctcgggcgtgtgggaggtgttcctg
ccgggcgtcggcgagggcgagcgctacaagtaccagatcctcacccggcacgggcagcgg
ctggagaaggccgacccgctggcccgggccgcccagtgcccgccggacaccgcctcggtg
gtgacggtctcccggcacgagtggcaggacgccgagtggatggagcggcgggcccgcgcc
gtccaccaccgggccccgctgtcggtctacgagctgcacctggcgtcctggcgcccggag
ctgaccacgtaccgggagatcgccgaggtgctgcccggctacctgaccgaactcggcttc
acgcacgtggagttcatgccggtgatggagcacccgttcggcggctcctggggctaccag
gtctccggcttctacgccccgacggcccggctcggcacccccgacgacttccgcttcctg
gtcgacaccctgcaccggcacggcatcggcgtgctggtcgactgggtgcccgcgcacttt
ccgaaggacgacttcgcgctggcccggttcgacggcgagccgctgtacgagccggccgac
ccgctgcgcgccgagcacccggactgggggacgctggagttcgactacggccgcaccgag
gtgcgcaacttcctggtcgccaacgcggtgtactggtgcgaggagttccacgtcgacggc
ctgcgggtggacgcggtcgcctcgatgctctacctcgactactcccgcgagggcggcgcc
tggacgcccaaccagtacggcggccgggagaacctggacgcggcctccttcctgcaggag
atgaacgccaccgtctaccggcgctgccccggggtgctgacggtcgccgaggagtccacc
gcctgggacggcgtgacccggccgaccgacagcggcggcctgggcttcgggctgaagtgg
aacatgggctggatgcacgactcgctggtgtacatctccaaggagccggtgcaccgcagg
taccaccacgacgagatcaccttctcgatggtgtacgcctactcggagaactacatcctg
ccgatctcgcacgacgaggtggtgcacggcaagcgggcgctggtctccaagatgcccggc
gactggtggcagcagcgcgccaaccaccgcgcctacctgggcttcatgtgggcccacccg
ggcaagcaactcctgttcatggggcaggagttcgcccagggcgcggagtgggaccacgag
agcggcccgcagtggtgggtgctggacgagggctggccggcgcacggcgaccaccgcggc
gtgcagcggctggtcggcgacctgaaccacgtctaccgggacaccccggcgctgtacgag
caggacaccgtcccggccgggttcgcctggctggacggcggggcggccgaggacaacgtg
ctgtccttcgtccggttcgcggcggacggcagcccgctggtcgcggtctgcaacttctcc
ccggtggtccggcacggcttccgggtcggcctgccccgactggagggcgccgagcagctg
tgggaggaggcgctgaacaccgacgccgagcggtacggcggcggcggggtggccaactcc
agcccggtgaagtcggagccggagccgtggaacgcgcagccgcgctcggccgagctggtg
ctgccgccgctggccaccgtctggctccggccggcccgctga

DBGET integrated database retrieval system