KEGG   Kitasatospora setae: KSE_53800Help
Entry
KSE_53800         CDS       T01648                                 

Definition
putative siderophore biosynthesis protein
Organism
ksk  Kitasatospora setae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5995220..5996980
Genome map
AA seq 586 aa AA seqDB search
MASTLTGVPPAVQPAAGHPAPDPLLDPDPAVAAEHAATESLLRCWARETAAERPDGDLLR
IPVLGGAAELSAPVRHWSACGWHRFGPAAVSTGTAGHPVDAVTVAALVAGATGRPEPGQL
ADLTARVADSVGRTAEILTHRRTISAAPADPFLRAEQSLLLGHPLHPTPKSRDGLGPAQS
AAYSPELHGSFRLHWWAAHRSLLAGDSAAGTPVERLTAELYGRTPPAGTAVLPLHPWQAR
ELALRPAVAELLELGLLTDLGQHGEPWHPTSSVRTVCRPGTPWMLKLSLGLRITNSRREN
LRKELHRGAEVHRLLEAGLSDRWKAAHPGFDIVRDPAWIGVDHPALADPNGLDTVLRQMP
FGPADRALCVAGLVAEQPIGRLDSQLSDIIGELAARTGRSTPTVATEWFLRYLDAVVLPI
LWLDGQAGIALEAHQQNSLVLLDTLGWPTGGRYRDNQGYYFRASHADRLRALLPNLGEHS
DTFVPDPVADERFAYYLGINHVLGLIGAFGSQGLADEQLLLAALRRFLAGPAATATGSGL
PAHLLDAPTLRCKANLLTRLHGLDELVGPVETQSVYVEIDNPVARA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
ttggccagcaccctcaccggcgtccccccggccgtccagccggcggccgggcaccccgcc
ccggacccgctgctcgaccccgacccggccgtcgccgccgaacacgccgccaccgagagc
ctgttgcgctgctgggcccgggagaccgcggccgagcgccccgacggcgacctgctgcgg
atcccggtgctcggcggcgccgccgagctctccgcgccggtccggcactggtcggcctgc
ggctggcaccgcttcggcccggccgccgtctccaccggcaccgccgggcacccggtcgac
gcggtcaccgtcgccgccctggtggccggcgccaccggccgccccgaacccggccaactc
gccgacctcaccgcccgggtggccgactcggtcggccgcaccgccgagatcctcacccac
cgccggacgatctccgccgcgcccgccgacccgttcctgcgcgccgagcagtcgctgctg
ctcggccacccgctgcaccccaccccgaagagccgcgacggcctcggccccgcccagtcc
gccgcgtactccccggagctgcacggcagcttccggctgcactggtgggccgcgcaccgc
tcgctgctggccggcgactcggccgccggcaccccggtcgagcggctcaccgccgagctg
tacggccgcaccccgcccgccgggaccgccgtgctgccgctgcacccctggcaggcccgg
gagctggcgctgcgcccggccgtcgccgaactgctggagctcggcctgctcaccgacctc
ggccagcacggcgagccctggcaccccaccagctcggtgcgcaccgtctgccggcccggc
accccgtggatgctcaagctctcgctgggcctgcggatcaccaactcccgccgggagaac
ctccgcaaggaactgcaccgcggcgccgaggtgcaccggctgctggaggccggcctgtcc
gaccgctggaaggccgcccaccccggtttcgacatcgtccgcgacccggcctggatcggc
gtcgaccaccccgcgctggccgaccccaacggcctggacaccgtgctgcggcagatgccg
ttcggccccgccgaccgggcgctctgcgtcgccggactggtcgccgagcagccgatcggc
cgactcgactcgcaactgtcggacatcatcggcgagttggccgcccgcaccggccgctcc
acgccgaccgtcgccaccgagtggttcctccgctacctggacgccgtcgtcctgccgatc
ctctggctggacgggcaggccggcatcgccctggaggcccaccagcagaacagcctggtc
ctgctggacaccctcggctggcccaccggcggccgctaccgcgacaaccagggctactac
ttccgcgcctcgcacgccgaccggctgcgcgccctgctgcccaacctcggcgagcacagc
gacaccttcgtgcccgacccggtcgccgacgagcgcttcgcctactacctcggcatcaac
cacgtcctcggcctgatcggcgccttcggctcccagggcctcgccgacgaacagctgctg
ctggccgcgttgcgccgcttcctggccggccccgccgccaccgccaccggctccgggctg
cccgcccacctgctggacgcccccaccctgcgctgcaaggccaacctgctcacccggctg
cacggcctggacgaactggtcggcccggtcgagacccagtcggtgtacgtcgagatcgac
aacccggtggcccgggcgtga

DBGET integrated database retrieval system