KEGG   Kitasatospora setae: KSE_54430Help
Entry
KSE_54430         CDS       T01648                                 

Definition
putative helicase RecD/TraA family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ksk  Kitasatospora setae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KSE_54430
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     KSE_54430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6085961..6088159
Genome map
AA seq 732 aa AA seqDB search
MQLAQVEGVLERITYANEETGYTVARVDTGRGANDLLTVVGALLGAQVGESLRLFGRWGS
HPQYGRQFTVENYTTVLPATVQGIQRYLGSGLIKGIGPRFAERIVERFGAETLEVIENEP
KRLIEVPGLGPKRTKMIAKAWEEQKSIKEVMVFLQGVQVSTSLAVRIYKQYGDGSIGVVK
NQPYRLASDVWGIGFLTADRIAQAVGIPHDSPERVKAGLQYALSQSTDSGHCYLPEERLI
ADGVKLLQVDVGLVIDCLAELVAAEGVVRERLPGGTGEEVTAVYLVPFHRAELSMAGQLL
RLLRTGEDRMPWFRDVDWPAALGWLAGRTGAELAPEQEQSVRLALTEKVAVLTGGPGCGK
SFTVKSIVQLALAKRAKVVLAAPTGRAAKRLAELTGAEASTVHRLLELKPGGDAAYDRDR
PLDADLVVVDEASMLDLILANKLVKAVAPGAHLLFVGDVDQLPSVGAGKVLRDMLAPGSP
IPSVRLTRIFRQAQQSGVVVNAHRINEGLPPKTDGLPDFFLFAEEDTERAAGLTVEVVAR
RIPQRFGLDPRRDVQVLAPMHRGPAGAGALNTLLQAAVTPAREGLAERRFGGRTFRVGDK
VTQIRNNYDKGRGGVFNGTVGVVTALSVDDQRLTVLTDEDEEIPYDFDELDELAHAYAVT
IHRSQGSEYPAVVIPVTMSAWPMLQRNLLYTAVTRAKKLVVLVGSRKAIAQAVRSLSTER
RHSALDHRLAAG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
ttgcagctggctcaggtggagggggtcctggagcggatcacgtacgccaacgaggagacg
gggtacacggtcgcccgggtggacaccgggcgcggggcgaacgacctgctgacggtggtc
ggggcgctgctgggggcgcaggtgggggagagcctgcggctgttcggccggtggggctcg
cacccgcagtacgggcggcagttcacggtggagaactacacgacggtgctgccggccacc
gtccagggcatccagcgctacctcggctcggggctgatcaagggcatcggcccgcggttc
gcggagcggatcgtggagcgcttcggggcggagaccctggaggtgatcgagaacgagccc
aagcggctgatcgaggtgcccggcctgggcccgaagcggacgaagatgatcgcgaaggcg
tgggaggagcagaagtccatcaaggaggtgatggtcttcctgcagggcgtgcaggtgtcg
acgtcgctggcggtgcggatctacaagcagtacggcgacggctcgatcggggtggtgaag
aaccagccgtaccgcctggcgtcggacgtgtggggcatcggcttcctgacggcggaccgg
atcgcgcaggcggtcggcatcccgcacgactcgcccgagcgggtgaaggcgggcctgcag
tacgcgctgtcgcagtccaccgacagcgggcactgctacctgcccgaggagcggctgatc
gcggacggcgtgaagctgctgcaggtggacgtcggcctggtgatcgactgcctggcggag
ctggtcgcggcggagggggtggtgcgcgagcggctgccgggcggcaccggggaggaggtc
acggcggtgtacctggtgccgttccaccgggcggagctctcgatggcgggccagctgctg
cggctgctgcgcaccggcgaggaccggatgccgtggttccgggacgtcgactggccggcc
gcgctgggctggctggccgggcggacgggcgcggaactcgccccggagcaggagcagtcg
gtgcgcctggcgctgaccgagaaggtcgcggtgctgaccggcggcccgggctgcggcaag
tcgttcacggtgaagtcgatcgtccagctggcgctggccaagcgggcgaaggtggtgctg
gcggcgccgaccgggcgggcggcgaagcggctggcggagctgaccggcgccgaggcgtcc
acggtgcaccggctgctggagctgaagcccggcggggacgccgcgtacgaccgggaccgg
ccgctggacgccgacctggtggtcgtcgacgaggcctcgatgctggacctcatcctggcg
aacaagctggtcaaggcggtcgcgccgggcgcccacctgctcttcgtgggggacgtcgac
cagctgccctcggtgggcgccggcaaggtgctgcgggacatgctggcgcccggcagcccg
atcccgtcggtgcggctgacccggatcttccggcaggcccagcagtccggcgtggtggtc
aacgcgcaccggatcaacgagggcctgccgccgaagaccgacggcctgccggacttcttc
ctgttcgccgaggaggacaccgagcgcgccgccggcctgaccgtcgaggtggtggcccgc
cggatcccgcagcgcttcggcctcgacccgcgccgcgacgtccaggtgctggccccgatg
caccgcggcccggccggcgccggcgcgctgaacacgctgctccaggcggccgtcaccccg
gcccgcgagggcctggccgaacgccgcttcggcgggcggacgttccgggtcggcgacaag
gtcacccagatccggaacaactacgacaaggggcgcggcggcgtcttcaacggcaccgtg
ggcgtggtgacggcactgagcgtggacgaccagcggctgaccgtgctgaccgacgaggac
gaggagatcccgtacgacttcgacgagctcgacgagctggcgcacgcgtacgcggtgacg
atccaccgttcgcagggcagcgagtacccggcggtggtgattcccgtcacgatgtcggcg
tggccgatgctccagcggaacctgttgtacacggcggtgacccgggcgaagaagctggtg
gtgctcgtcggatcacgcaaggccatcgcgcaggcggtgcggtcgctgagcaccgagcgg
cggcactccgcgctggaccacagattggctgcggggtga

DBGET integrated database retrieval system