KEGG   Kitasatospora setae: KSE_54900Help
Entry
KSE_54900         CDS       T01648                                 

Gene name
malQ
Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ksk  Kitasatospora setae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ksk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6146430..6148631
Genome map
AA seq 733 aa AA seqDB search
MAAYLDREHAGSEQVPAEDNPPAPPELTALAHAYGVDTRYDAGAGPVEVGARTLTAVLAA
LGVDAGTPESTAQALERHREDAAARLLPPTVVAWRGRRTALDLPAGAEVRIELEQGGEAW
ELTAEHAHWLPEDLPLGRHALDVRAGERAARAVLVVAPARIPEPRGRSWGFLAQLYSVLS
ERSWGMGDLADLAELAQWAGAELGAGFLQINPLHAGMPGAPSDPSPYRPSSRRFADPVHL
RIEAVPEYARHDGVRDLARRARLLREEVLEHDALIDRDAVWSLKRQALELLHTVERGVGR
EAAYRAFVRREGEWLERYAVWNALAEAHGGGWHAWPKGLRHPANPQVAAAKAELKDRIEF
HRWLAWLVDEQLHAAQRAAVDAGMPIGLIHDLAVGVHPDGADAWALQDVLAAGISTGAPP
DAFNAHGQDWGLPPWRPDALAEAGYAPFAELIRASARHAGAIRIDHVMGLFRLWWVPAGA
RPTEGTYVRYDAEAMLAVLALEAHRAGAAVIGEDLGTVEPGVRERLADHGVLGTSVLWFE
RDWQAGGAVLPPERWRPGCLATLTTHDLPSTAARLTGEHVELRHHLGLLARPLAEEQDAA
ARELADWQRELVRIGVLAENEPATPEALYAYLLATPAALVGVWLPDTVGDPRPQNLPGTW
DQYPNWRLPVADADGTPRTLDALAAAAGTAGIAATLAPLDAPPAPPAAVPSAPPAAVRPA
GHADRRTPPGAAL
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcataccttgaccgcgagcacgcggggtccgagcaggtcccggcggaggacaac
ccgcccgccccaccggagttgacggcgctggcgcacgcgtacggggtggacacccgctac
gacgccggggccggtccggtggaggtcggcgcgcggacgctgaccgccgtgctggccgcg
ctcggggtcgacgccgggacgccggagtcgaccgcgcaggcgctggagcggcaccgcgag
gacgccgcggcccggctgctgccgcccaccgtggtggcctggcgggggcggcgcaccgcg
ctggacctgccggccggggccgaggtccggatcgagctggaacagggcggcgaagcctgg
gagttgacggccgagcacgcgcactggctgcccgaggacctgccgctcggccggcacgcg
ctggacgtccgggccggcgaacgggccgcccgggccgtcctggtggtcgccccggcgcgg
atccccgaaccgcgcggccgctcctggggcttcctcgcccagctgtactcggtgctgagc
gaacgctcctggggcatgggcgacctggccgacctcgccgagctcgcccagtgggccggc
gccgaactcggcgcgggcttcctgcagatcaacccgctgcacgcgggcatgcccggcgcc
ccctccgacccgtccccgtaccgcccgtcctcgcgccgcttcgccgacccggtgcacctg
cggatcgaggccgtccccgagtacgcccggcacgacggggtccgcgacctggcccggcgg
gcccggctgctgcgcgaggaggtgctggagcacgacgcgctgatcgaccgcgacgcggtc
tggtcgctcaagcgccaggccctggagctgctgcacaccgtggagcgcggggtcggccgg
gaggccgcgtaccgggcgttcgtccggcgcgagggcgagtggctggagcggtacgcggtg
tggaacgcgctggccgaggcgcacggcggcggctggcacgcctggccgaagggcctgcgc
caccccgccaacccgcaggtggccgccgccaaggccgagttgaaggaccggatcgagttc
caccgctggctggcctggctggtcgacgagcagctgcacgccgcccagcgggccgccgtc
gacgccggcatgccgatcggcctgatccacgacctcgcggtcggcgtccaccccgacggc
gccgacgcctgggccctccaggacgtgctggccgccggcatctccaccggcgccccgccg
gacgcgttcaacgcccacggccaggactggggcctgccgccctggcgccccgacgccctc
gccgaggccggctacgccccgttcgccgagctgatccgggcctccgcccggcacgccggc
gcgatccggatcgaccacgtgatgggcctgttccggctctggtgggtcccggccggggcc
cgccccaccgagggcacctacgtccgctacgacgccgaggcgatgctcgccgtcctcgcc
ctggaggcccaccgggccggcgccgccgtcatcggcgaggacctcggcaccgtcgagccc
ggcgtccgcgagcggctcgccgaccacggcgtgctcggcacctcggtgctctggttcgaa
cgggactggcaggccggcggcgccgtgctgccccccgagcgctggcgccccggctgcctg
gccaccctcaccacccacgacctgccctccaccgccgcccggctgaccggcgaacacgtc
gagctccgccaccacctcggcctgctggcccgcccgctggccgaggagcaggacgccgcc
gcccgcgaactcgccgactggcagcgcgaactcgtccggatcggcgtgctcgccgagaac
gagcccgccacccccgaggcgctgtacgcctacctgctggccacccccgccgcgctggtc
ggcgtctggctccccgacaccgtcggcgacccccgcccgcagaacctccccggcacctgg
gaccagtaccccaactggcgcctcccggtcgccgacgccgacggcaccccccgcaccctc
gacgccctcgccgccgccgccggcaccgcgggcatcgccgccaccctcgccccgctcgac
gccccgcccgcgccgccggccgccgtcccgtccgcgccgccggctgcggtccggccggcg
ggacacgccgacaggcgcaccccgccgggcgcggcactgtag

DBGET integrated database retrieval system