KEGG   Kitasatospora setae: KSE_55420Help
Entry
KSE_55420         CDS       T01648                                 

Gene name
tpiA
Definition
putative triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ksk  Kitasatospora setae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KSE_55420 (tpiA)
   01230 Biosynthesis of amino acids
    KSE_55420 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_55420 (tpiA)
   00051 Fructose and mannose metabolism
    KSE_55420 (tpiA)
   00562 Inositol phosphate metabolism
    KSE_55420 (tpiA)
Enzymes [BR:ksk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KSE_55420 (tpiA)
Exosome [BR:ksk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KSE_55420 (tpiA)
  Exosomal proteins of bladder cancer cells
   KSE_55420 (tpiA)
  Exosomal proteins of melanoma cells
   KSE_55420 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6208099..6208884
Genome map
AA seq 261 aa AA seqDB search
MTERLPLMAGNWKMNLDHLEAIQHTQKLAFSLADKDYEAVEVAVLVPFTDLRSVQTLVDG
DKLKLKYGSQDISRHDGGAYTGEISGPMLAKLKAAYAVIGHSERRQYHGENEEIVNAKVK
AAYRHGITPILCIGEPLEVRKAGTHVAHTLAQLDGALDGVPASDAESVVVAYEPVWAIGT
GEVATPEDAQEVCGAIRARLAELYGPELAGKVRVLYGGSVKSSSAAGLMAKPDVDGALIG
GASLDAEEFVKIVRYREQAVG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgtctcccgctgatggcgggcaactggaagatgaacctcgaccacctcgag
gccatccagcacacccagaagctggcgttctcgctggccgacaaggactacgaggccgtc
gaggtcgccgtcctggtcccgttcaccgacctgcgctcggtgcagaccctggtcgacggc
gacaagctgaagctcaagtacggctcgcaggacatctcgcggcacgacggcggggcctac
accggcgagatctccggcccgatgctggcgaagctgaaggccgcctacgcggtgatcggc
cactccgagcgccgccagtaccacggcgagaacgaggagatcgtcaacgccaaggtgaag
gccgcctaccgccacgggatcaccccgatcctgtgcatcggcgagccgctggaggtccgc
aaggcgggcacccacgtcgcgcacaccctggcgcagctcgacggcgcgctggacggcgtc
ccggcgtccgacgccgagagcgtcgtcgtcgcgtacgagccggtctgggcgatcggcacc
ggcgaggtggccacccccgaggacgcgcaggaggtctgcggcgcgatccgggcccggctc
gccgagctgtacggccccgagctggccggcaaggtccgcgtgctgtacggcggttcggtg
aagtcctcgtccgcggccggcctgatggccaagccggacgtcgacggcgccctgatcggc
ggtgcctcgctggacgccgaggagttcgtcaagatcgtgcgctaccgtgagcaggcagta
ggctaa

DBGET integrated database retrieval system