KEGG   Kitasatospora setae: KSE_56400Help
Entry
KSE_56400         CDS       T01648                                 

Definition
putative magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ksk  Kitasatospora setae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KSE_56400
Enzymes [BR:ksk01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     KSE_56400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6302656..6304725)
Genome map
AA seq 689 aa AA seqDB search
MTEARYPFTAIVGMDDLRLGLLLNAVSPAVGGVLVRGEKGTAKSTMVRALAGLLPSIATV
PGCRFACDPAAPDPQCPDGPHDGGAAAERPAFLVELPVGVSEDRVVGALDLERALAEGVQ
AYEPGLLAKAHRGVLYIDEVNLLQDHLVDLLLDAAAMGRSYVEREGVSVRHAARFLLVGT
MNPEEGELRPQLLDRFGLTVEIAATRDADERAEVVRRRLAYDADPAGFAARWDERERELA
ERITAARELLADVELSDLALRQITAVCAAFEVDGLRADIVMARTAVALAAWAGRGAVLEE
DVRTAARLALPHRRRRNPFDAPGLDEEQLDRTLAEHQPPEDPEDPEGPEDPEGPEDDGPG
GGPDGGGPDGGGAPEPEPGDGNAPSGEAGSDESPAPPRQRPGGGRESAPVAADQPYRTRL
FTVDGTGRGAQGRRSPAETDAGHTIRARRPRGRLSRLHLSATLRAAAPHQVARGRAGRAL
VLRRDDLREQVRRGRESNLVLFVVDASGSMAARQRMTAVKGAVLSLLMDAYQRRDKVGLV
TFRGAGAELALPPTSSVEVGAARLEQLPTGGRTPLEAGLLRAHEVLRVERLRDPDRRPLL
VLVTDGRATGGKDALPRARRAAGLLAAQGVAAVVLDCESGPVRLGLARELAAHLNGDAVS
LDELRAEGVASLVREARTTMTMTTTRKAA
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaggcccgttatccgttcacggcgatcgtgggcatggacgacctgcggctgggg
ctgttgctgaacgcggtctcgccggccgtgggcggggtgctggtgcggggcgagaagggg
acggcgaagtcgacgatggtgcgggccctggcagggctgctgccgtcgatcgcgacggtg
ccggggtgccggttcgcctgcgacccggcggcgccggacccgcagtgcccggacgggccg
cacgacggcggggcggcggccgaacgcccggcgttcctggtggagttgccggtgggcgtc
tcggaggaccgggtggtcggcgcgctggacctggagcgggcgctcgccgagggcgtgcag
gcgtacgagccggggctgctggcgaaggcgcaccgcggcgtgctgtacatcgacgaggtg
aacctgctccaggaccacctggtggacctgctgctggacgcggcggcgatgggccgctcg
tacgtggagcgggagggcgtgtcggtgcggcacgcggcccggttcctgctggtcgggacg
atgaacccggaggagggtgagctgcggccgcagctgctggaccggttcggcctgaccgtg
gagatcgcggcgacccgggacgcggacgagcgcgccgaggtggtgcgccggcggctcgcg
tacgacgccgacccggccggcttcgccgcgcgctgggacgagcgggagcgggagctcgcc
gaacggatcaccgccgcacgggagttgctggccgacgtcgagctgtccgacctggcgctg
cggcagatcacggcggtctgcgcggcgttcgaggtggacggcctgcgcgcggacatcgtg
atggcccggacggcggtcgcgctggccgcctgggcggggcgcggcgcggtgctggaggag
gacgtccggaccgccgcccggctggcgctgccgcaccggcggcggcgcaacccgttcgac
gcgccggggctggacgaggagcagctggaccgcacgctggccgagcaccagccgccggag
gacccggaggacccggagggcccggaggacccggagggccccgaggacgacggccccggc
ggcggtccggacggcggcggcccggacggcggcggggcgccggagccggagccgggtgac
ggcaacgccccgagcggggaggccggttcggacgagtcgcccgccccgccccggcaacgc
ccgggcgggggacgggagtcggcgccggtcgcggccgatcagccgtaccgcaccaggctg
ttcacggtggacgggacgggccggggcgcgcagggccggcgctcccccgccgagacggac
gccgggcacaccatccgggcccgccgcccgcgcggccggctgtcccggctgcacctgagc
gcgacgctgcgcgcggccgccccgcaccaggtggcgcgcgggcgggccgggcgggcgctg
gtgctgcgccgggacgacctgcgggagcaggtgcgccggggccgggagtcgaacctggtg
ctgttcgtggtggacgcctcgggttcgatggcggccaggcagcggatgacggcggtgaag
ggcgcggtgctgtccctgctgatggacgcgtaccagcggcgcgacaaggtcgggctggtg
acgttccggggcgcgggcgccgagttggcgctgccgccgacctcctcggtggaggtgggc
gcggcccggctggagcagttgccgaccggcggccggacgccgctggaggcgggcctgctg
cgggcgcacgaggtgctgcgggtggagcggctgcgcgacccggaccggcgtccgctgctg
gtgctggtgaccgacggccgggccaccggcgggaaggacgcgctgccgcgggcccgccgg
gcggccggcctgctggcggcgcagggcgtggccgcggtggtgctggactgcgagtccggc
ccggtccggctgggcttggcacgggagttggccgcgcacctgaacggtgacgcggtgagc
ctggacgagctgcgggccgagggggtggcctcgctggtgcgggaggcccggaccacgatg
acgatgacgacgacgcgaaaggcggcgtga

DBGET integrated database retrieval system