KEGG   Kitasatospora setae: KSE_58800Help
Entry
KSE_58800         CDS       T01648                                 

Gene name
pcm
Definition
putative protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ksk  Kitasatospora setae
Brite
Enzymes [BR:ksk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     KSE_58800 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6589111..6590334
Genome map
AA seq 407 aa AA seqDB search
MTSIDDSLVRDPGVLRSDMVRALREQDGIRSEPVAAAFAAVPRHRFAPEAPLELVYDPHR
TVPVKKDENGLELSVMSAAHLQAVMLEQAGVEPGMKVLEIGSGGVNAAYLQELVGKAGEV
TTVDIDCDVIDRARRCLDDAGYPQVRTVLADGESGVPDGSPYDLITVTAAAWDIPPSWIS
GLAPSGRLVVPLTVCGTTRSIAFDRDRGPESDDEGLVSRSYSLARFVPMQGEGAAEERRV
LLREGVAVQTDDVRVPLDAQALNRALDGPRLECWSGAAYDLPDELELYLTFNLSSPARLH
AANDVVERGLVEASALFGVPVLVSEDSFAYRTRRENADTGGFESGVVAHGPGAQALADEY
ATLLRRWARDHRRRGAATFRYLPGPVPVPLPRNAVRRRHGIVTATWR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacttccatcgacgactcgttggtccgcgatcccggcgtgctgcgctcggacatggtc
cgtgcgctgcgcgagcaggacgggatcaggtccgagccggtcgccgccgccttcgcggcg
gtgccccgccaccggttcgcaccggaggcgcctctggagctcgtctacgatccgcaccgc
acggtgccggtcaagaaggacgagaacggcctggagctcagcgtcatgtctgccgctcat
ctgcaggccgtgatgctggagcaggccggagtcgagcccggcatgaaggtattggagatc
ggttccggcggcgtcaacgccgcctatctccaggaactcgtcggcaaggcgggcgaggtc
accaccgtcgacatcgactgcgatgtcatcgaccgggcccgacgatgcctggacgatgcg
ggatacccccaggtgcggacggtcctggccgacggtgagagcggcgtgcccgacggctct
ccgtacgacctgatcaccgtcacggccgccgcgtgggacatccccccgtcgtggatcagc
ggtctggcgccgtccggccgtctcgtcgtgccgctgacagtctgtggcacgacccgctcg
atcgccttcgaccgtgaccgcggccccgagagcgacgacgagggtctggtcagccgttcc
tacagcctggcccggttcgtgcccatgcagggagaaggggcggcggaagaacgccgggta
ctgctccgcgagggtgtggccgtacagaccgacgacgtgcgggtaccgctcgacgcccag
gcgctgaaccgcgcgctcgacgggcccaggctggagtgctggtccggggccgcgtacgac
ctgcccgacgagttggagctgtacctgacgttcaacctgtcgagcccggcccgcctgcac
gccgccaacgacgtggtggagcgcggcctcgtggaggcgtccgcgctgttcggggtgccc
gtcctggtgagcgaggacagcttcgcctaccgcacccgccgcgagaacgcggacaccggc
ggcttcgagagcggcgtggtcgcccacgggcccggtgcccaggcgctcgccgacgagtac
gccacgctgcttcgccgctgggcccgtgaccaccgtcgtcggggtgccgcgacgttccgc
tacctgccgggccccgtgcccgttcccctgccccggaacgccgtccggcgacgccacggc
atcgtcacggcgacctggcgctga

DBGET integrated database retrieval system