KEGG   Kitasatospora setae: KSE_59480Help
Entry
KSE_59480         CDS       T01648                                 

Gene name
xynB
Definition
putative endo-1,4-beta-xylanase B precursor
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ksk  Kitasatospora setae
Brite
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     KSE_59480 (xynB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6667881..6668870)
Genome map
AA seq 329 aa AA seqDB search
MASPTHPHRRTDHLVNLPRSLRRVRVLPLALAAVVLLPGTADAATVTTNQTGSDGGYFYS
FWTEGTGSASMSLNGGGNYGTSWTNAGNFVAGKGWSTGSRNPVTYSGTWSTNGNAYLSLY
GWTTNPLVEYYVVENYGSYKPTGTYKGTVTSDGGTYDIYETTRVNAPSIEGNKTFNQYWS
VRQSKRTGGTITVGNHFDAWAQHGMNLGTMNYEILATEGYQSSGSSNLTLGTTTGGGGGT
GGSCTATLSAGSSWSDRYNLNVDVTGAANWKVTVKVPSPEQVSATWNVNATYPDAQTLVA
TPNGSGNSWGLTLMKNGSTTWPTVSCTTA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtggcttcccccacccacccccaccgcagaacggatcacctcgtgaacctgccccgctcc
ctccgccgggtccgcgtcctcccgctggcgctggccgccgtcgtcctgctgcccggtacc
gccgacgcggcgaccgtcaccaccaaccagaccggcagcgacggcggttacttctactcg
ttctggaccgagggcaccggctcggcctcgatgtcgctgaacggcggcggcaactacggc
acctcctggaccaacgcgggcaacttcgtcgcgggcaagggctggagcaccggctcgcgc
aacccggtgacgtactcgggcacctggagcaccaacggcaacgcctacctgtcgctgtac
ggctggaccaccaacccgctggtcgagtactacgtggtcgagaactacggctcgtacaag
ccgaccggcacctacaagggcaccgtcaccagcgacggcggcacgtacgacatctacgag
acgacccgggtcaacgccccctccatcgagggcaacaagaccttcaaccagtactggagc
gtccgccagtcgaagcggaccggcggcaccatcaccgtcggcaaccacttcgacgcctgg
gcccagcacggcatgaacctcggcaccatgaactacgagatcctggcgaccgagggctac
cagagcagcggcagctccaacctcaccctcggcaccaccaccggcggcggtggcggcacc
ggtggcagctgcaccgccacgctgtcggccggcagctcctggagcgaccgctacaacctg
aacgtcgacgtcaccggcgccgccaactggaaggtcaccgtcaaggtccccagccccgag
caggtcagcgccacctggaacgtcaacgccacctacccggacgcccagaccctggtggcc
acccccaacggctccggcaactcctggggcctgaccctcatgaagaacggctccaccacc
tggccgaccgtctcctgcaccaccgcctga

DBGET integrated database retrieval system