KEGG   Kitasatospora setae: KSE_60290Help
Entry
KSE_60290         CDS       T01648                                 

Definition
putative aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ksk  Kitasatospora setae
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KSE_60290
Enzymes [BR:ksk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KSE_60290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6757308..6758159)
Genome map
AA seq 283 aa AA seqDB search
MADSFATSKSALVDLAQQRMRTAIPDNDWSIRQKLALTCRILFDAGHDSGLAGQITARAE
QPGTYWTQRLGLGFDEVTEDNLLLVDEDLNVLAGEGMANPANRFHSWVYRARPDVNCIIH
THPLHISGLSMLETPLVVSHMDLCPLYDDCAFLEKWPGIPVGNEEGELISAALGDKRALL
LAHHGQLVATASVEESCTLAVLFERAARLQLLASASGRIQEIPELLAQEAHDWTSTPKRS
QANFAYYARRALRAGHGDALTTPLTSTSTSTTSTTNSPKDGPR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagcttcgccacctcgaaatccgctctcgtcgacctcgcccagcagcggatg
cgcaccgccatccccgacaacgactggtcgatccgccagaagctcgccctcacctgccgc
atcctgttcgacgccggccacgactccggcctggccgggcagatcaccgcccgcgccgaa
cagcccggcacctactggacgcagcgcctgggcctcggcttcgacgaggtcaccgaggac
aacctgctgctggtcgacgaggacctgaacgtcctggccggcgagggcatggccaacccg
gccaaccgcttccactcctgggtctaccgggcccggccggacgtcaactgcatcatccac
acccacccactgcacatctcggggctctccatgctggagaccccgctggtggtctcgcac
atggacctgtgcccgctgtacgacgactgcgcgttcctggagaagtggcccggcatcccg
gtcggcaacgaggagggcgagctgatctccgccgcgctcggcgacaagcgcgccctgctg
ctcgcccaccacgggcagttggtcgccaccgcgagcgtcgaggagtcctgcaccctcgcc
gtgctgttcgagcgggccgcccggctccagctgctggcctccgcctccggccggatccag
gagatccccgaactgctcgcccaggaggcccacgactggacctccacccccaagcgcagc
caggccaacttcgcctactacgcccgccgcgccctgcgggccggccacggcgacgcgctg
accacccccctcacctccacctccacctccaccacctccaccaccaactcccccaaggac
ggcccccgttga

DBGET integrated database retrieval system