KEGG   Kitasatospora setae: KSE_61770Help
Entry
KSE_61770         CDS       T01648                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ksk  Kitasatospora setae
Pathway
ksk00071  Fatty acid degradation
ksk00280  Valine, leucine and isoleucine degradation
ksk00281  Geraniol degradation
ksk00310  Lysine degradation
ksk00360  Phenylalanine metabolism
ksk00362  Benzoate degradation
ksk00380  Tryptophan metabolism
ksk00410  beta-Alanine metabolism
ksk00627  Aminobenzoate degradation
ksk00640  Propanoate metabolism
ksk00650  Butanoate metabolism
ksk00903  Limonene and pinene degradation
ksk00930  Caprolactam degradation
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01212  Fatty acid metabolism
Module
ksk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KSE_61770
   00650 Butanoate metabolism
    KSE_61770
  Lipid metabolism
   00071 Fatty acid degradation
    KSE_61770
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KSE_61770
   00310 Lysine degradation
    KSE_61770
   00360 Phenylalanine metabolism
    KSE_61770
   00380 Tryptophan metabolism
    KSE_61770
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KSE_61770
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KSE_61770
   00281 Geraniol degradation
    KSE_61770
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KSE_61770
   00627 Aminobenzoate degradation
    KSE_61770
   00930 Caprolactam degradation
    KSE_61770
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KSE_61770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: BAJ31942
NITE: KSE_61770
UniProt: E4N1A8
Position
complement(6944688..6945773)
Genome map
AA seq 361 aa AA seqDB search
MATPEHQQDVLIERTGPLGRITLNRPRALNSLTRPMLETVRAALDGWADDDRVSAVLLSG
AGERGLCAGADIRAVHDDAKLGGAGTRAFFRVEYPLNELVSRYPKPYVALMDGITMGGGV
GLSGHAGVRIVTERSAVAMPETRIGLVPDVGGSRLLALAPGELGTHLGLTAATMTAGDAL
HCGFADHFVPAAALPGLTARLAAGQDPAAAVAALAEPAPPSDLAGQREWIDRCYAADSVE
EIVERLRATGLPAAKDAVEQLLGKSPTMLKVTLAALRRARALPSLAATLDQEYRISCAAL
AHHDLVEGIRAQVVDKDRDPHWSPATLAGVSAADVARFFVPPADGDLGLAAGPAGPADPA
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccggagcaccagcaggacgtgctgatcgagcggaccggaccgctcgggcgg
atcacgctcaaccggccgcgggcgctcaactcgctgacccggcccatgctggagaccgtc
cgcgccgccctggacggctgggccgacgacgaccgggtgagcgccgtcctgctgagcggc
gcgggcgagcgcggcctgtgcgcgggcgccgacatccgggccgtgcacgacgacgccaag
ctcggcggcgcgggcacccgggcgttcttccgggtcgagtacccgctgaacgaactggtc
tcccgctacccgaagccgtacgtcgcgctgatggacggcatcacgatgggcggcggcgtc
ggcctgtccgggcacgcgggcgtccggatcgtcaccgagcgctcggccgtcgccatgccg
gagacccggatcggcctcgtcccggacgtcggcggcagccggctgctcgccctcgccccc
ggcgaactcggcacccacctcggcctcaccgccgccaccatgaccgccggcgacgccctg
cactgcggcttcgccgaccacttcgtgcccgccgccgcgctgcccggcctgaccgcccgg
ctcgccgccggccaggacccggccgccgccgtcgccgcgctcgccgaacccgccccgccg
tccgacctcgccgggcagcgcgagtggatcgaccgctgctacgccgccgacagcgtcgag
gagatcgtcgaacggctgcgcgccaccggcctgcccgccgcgaaggacgccgtcgagcag
ctgctcggcaagtcccccaccatgctgaaggtgacgctggccgcgctgcgccgggcccgc
gcgctgccgtcgctggccgcgaccctggaccaggagtaccggatctcctgcgcggcgctg
gcccaccacgacctggtcgaggggatccgcgcccaggtcgtcgacaaggaccgcgacccg
cactggtcccccgccaccctggccggggtctccgccgccgacgtcgcccgcttcttcgtg
cccccggccgacggcgacctgggcctggcggccggcccggccggcccggccgacccggcc
ggatga

DBGET integrated database retrieval system