KEGG   Kitasatospora setae: KSE_63370Help
Entry
KSE_63370         CDS       T01648                                 

Definition
putative uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ksk  Kitasatospora setae
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KSE_63370
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    KSE_63370
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     KSE_63370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7117876..7118796)
Genome map
AA seq 306 aa AA seqDB search
MAHVLGQNQYGKAENRIVRVYRDSTRHEIKDLNVSVSLRGDFEDVHLTGSNANCLPTDTT
KNTVYAFAKEHGIDSAEGFGVLLARHFVDSTERGVVRSARIRIEEYGWERIKTPDSSSRF
IGSEEVGHSFVRKGQEVRTTEVVYDGDRFRVVSGLKDLVVMNTTNSEFWGYIKDRYTTLQ
EAYDRILATQVTARWAFGFHGRDGEPEPNWNRSYQQVRRHLLEAFAETYSYSLQQTLHAM
GTRVLNNRAEVDEVRLELPNKHHFLVDLEPFGLKNDNEVYFAADRMYGLIEGTVHREGVT
PVIPVA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgtgctcggtcagaaccagtacggcaaggcggagaaccggatcgtccgggtc
taccgcgactcgacccgccacgagatcaaggacctgaacgtctcggtgtcgctgcgcggc
gatttcgaggacgtccacctcaccggctcgaacgccaactgcctgcccaccgacaccacc
aagaacaccgtgtacgccttcgccaaggagcacggcatcgactccgccgagggcttcggc
gtcctgctggcccggcacttcgtcgactccaccgagcgcggcgtggtgcgctccgcccgg
atccggatcgaggagtacggctgggagcggatcaagacccccgactcgtcctcccggttc
atcggctccgaggaggtcggccactccttcgtccgcaagggccaggaggtgcgcaccacc
gaggtggtgtacgacggggaccggttccgggtggtctccggcctcaaggacctggtggtg
atgaacaccaccaactccgagttctggggctacatcaaggaccggtacaccaccctccag
gaggcgtacgaccgcatcctggccacccaggtgacggcccgctgggcgttcggcttccac
ggccgcgacggcgagccggagccgaactggaaccgctcgtaccagcaggtgcgccgccac
ctgctggaggctttcgccgagacctactcctactcgctgcagcagaccctgcacgcgatg
ggcacccgggtgctgaacaaccgcgccgaggtggacgaggtccggctggagctgccgaac
aagcaccacttcctggtcgacctggagccgttcggactgaagaacgacaacgaggtctac
ttcgccgccgaccggatgtacggcctgatcgagggcaccgtgcaccgcgagggcgtcacc
ccggtcatcccggtcgcctga

DBGET integrated database retrieval system