KEGG   Kitasatospora setae: KSE_63960Help
Entry
KSE_63960         CDS       T01648                                 

Gene name
glk2
Definition
putative glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ksk  Kitasatospora setae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KSE_63960 (glk2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_63960 (glk2)
   00052 Galactose metabolism
    KSE_63960 (glk2)
   00500 Starch and sucrose metabolism
    KSE_63960 (glk2)
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_63960 (glk2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KSE_63960 (glk2)
   00524 Butirosin and neomycin biosynthesis
    KSE_63960 (glk2)
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KSE_63960 (glk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7177431..7178540
Genome map
AA seq 369 aa AA seqDB search
MTRADRPARPPRPALPNLLGLGPRAERRRRTLPAGVLRLPTVGVDIGGTKVVAGVVDGDG
NVVDRLRTETPDKSKSPRVVEDVIVDLVLELADKHDVHAVGVGAAGWVDAERSTVLFAPH
LNWRGEPLREALSARLRFPVVVENDANAAAWAEWRFGAGRGEDHMVMITLGTGIGGAVVR
DGRVDRGKHGLAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREARGLAAEESPVVQ
PLLARAGGTPLGITGPLVTEAARDGDPVAVELLYEVGRWLGVGIANLAAALDPGRFVIGG
GVSEAGDLLIGPARDAFGRTLTGRGFRPEADLVPAALGNEAGLVGAADLARQLARRFRTV
KRRRIGRDA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgccgaccgccccgcccgcccgccccgccccgccctgccgaacctgctgggc
ctcggcccgcgcgccgagcgccgccgccgcacgctgcccgccggagtgctgcggctcccc
accgtcggggtcgacatcggcggcaccaaggtggtcgcgggcgtggtcgacggcgacggc
aacgtggtggaccggctgcgcaccgagacccccgacaagagcaagagcccccgggtggtc
gaggacgtcatcgtcgacctcgtgctggaactcgccgacaagcacgacgtgcacgccgtc
ggcgtcggcgcggccggctgggtcgacgccgagcgctccaccgtgctgttcgccccgcac
ctgaactggcgcggcgaaccgctgcgggaggcgctcagcgcccggctgcggttccccgtc
gtggtggagaacgacgccaacgcggccgcctgggcggagtggcggttcggcgccgggcgc
ggcgaggaccacatggtgatgatcaccctcggcaccgggatcggcggcgccgtcgtccgg
gacggccgcgtcgaccggggcaagcacggcctggccggcgagttcggccacatgcaggtg
gtgcccggcggccaccgctgcccgtgcggcaaccggggctgctgggagcagtactcgtcc
ggcaacgcgctggtccgggaggcccgcggcctggccgccgaggagtccccggtggtccag
ccgctgctggcccgggccggcggcaccccgctgggcatcaccgggccgctggtcaccgag
gccgcccgggacggcgacccggtcgccgtcgaactgctctacgaggtcggccgctggctg
ggcgtcggcatcgccaacctcgccgccgcgctcgaccccggacgcttcgtcatcggaggc
ggcgtcagcgaggccggcgacctgctgatcggccccgcccgcgacgccttcggccgcacc
ctcaccggccgcggcttccgccccgaggccgacctcgtgcccgccgccctcggcaacgag
gccggcctggtcggcgccgcggacctggcccgccagctcgcccgccgcttccgcaccgtc
aagcgccgccggatcggacgcgacgcctga

DBGET integrated database retrieval system