KEGG   Kitasatospora setae: KSE_65420Help
Entry
KSE_65420         CDS       T01648                                 

Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ksk  Kitasatospora setae
Pathway
ksk00010  Glycolysis / Gluconeogenesis
ksk00620  Pyruvate metabolism
ksk00640  Propanoate metabolism
ksk00680  Methane metabolism
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_65420
   00620 Pyruvate metabolism
    KSE_65420
   00640 Propanoate metabolism
    KSE_65420
  Energy metabolism
   00680 Methane metabolism
    KSE_65420
Enzymes [BR:ksk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     KSE_65420
Lipid biosynthesis proteins [BR:ksk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   KSE_65420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAJ32301
NITE: KSE_65420
UniProt: E4N2B7
Position
complement(7351591..7353366)
Genome map
AA seq 591 aa AA seqDB search
MAPDTAARRNTDSAAHHDFRAARDHLLAARGDLDAAHAFPRPTGEHFNWALDWFDTEAAG
NDATALRVVDLDADGTLLGESALSFAELSARSDRTAGWLRERGVARGDRILLLLGNQVAL
WEVMLAAIKLGAVVIPASTLLTPDDLADRLTRGRVRHVIAESALTANFAQLDGDWTRTAV
GAPVPGWTDYADAAAHTGGFTPDGPTRADDPLLLYFTSGTTSSPKLVQHTHRSYPVGHLS
TMYWIGLRPGDVHLNVSSPGWAKHAWSNFFAPWNAGAEILIVNQPRFSARPLLDALVRHR
VTSFCAPPTVWRMLLLEDLEQWRPPLRELVGAGEPLNPEVVERIERAWGVALRDGYGQTE
TTAQIGNTPGQPVKPGSMGRPLPGYQVTLVDPVTGEEITGTGVDGELCLPLVSAPLGLMT
GYQDDPERHAESMAGGRYHTGDVAQRDADGYYTFVGRADDVFKSSDYRLSPFELESVLIE
HPAVAEAAVVPSPDPLRLSVPKAYVILAPGHEPDAATARSILAFTRKRLAPYKRIRRLEF
ADLPKTISGKIRRIELRGRERERHGEAEPLAARPRGEREFWEEDFPGLKDA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggcaccggacacggccgctcggcggaacaccgactccgccgcgcaccacgacttccgc
gccgcgcgggaccacctgctcgcggcacgcggcgacctcgacgccgcgcacgccttcccc
cgtccgacgggcgagcacttcaactgggcgctggactggttcgacaccgaggccgccggc
aacgacgcgaccgccctgcgcgtcgtcgacctggacgcggacggcaccctgctgggcgag
agcgcgctgagcttcgccgagctgagcgcccgctcggaccgcaccgccggctggctgcgc
gaacggggtgtggcgcgcggtgaccggatcctgctgctgctcggcaaccaggtcgccctg
tgggaggtgatgctcgccgcgatcaagctcggcgcggtcgtcatccccgccagtaccctg
ctgacccccgacgacctcgccgaccggctcacccgcggccgggtccggcacgtgatcgcc
gaatccgccctgaccgccaacttcgcccagctggacggcgactggaccaggaccgccgtc
ggcgcacccgtccccggctggacggactacgccgacgccgccgcccacaccggcggcttc
acccccgacgggccgacccgcgccgacgacccgctgctgctgtacttcacctccggcacc
accagcagccccaaactcgtccagcacacccaccgttcctaccccgtcggccacctctcc
accatgtactggatcggcctgcgccccggcgacgtccacctcaacgtctcctcccccggc
tgggccaagcacgcctggagcaacttcttcgccccgtggaacgccggcgccgagatcctc
atcgtcaaccagccccgtttctccgcccgccccctcctggacgccctggtgcgccaccgc
gtcacctcgttctgcgcaccccccaccgtctggcggatgctcctgctcgaggacctcgaa
cagtggcgccccccgctgcgcgaactcgtcggcgcgggcgagccgttgaaccccgaggtc
gtcgaacggatcgaacgcgcctggggcgtcgccctgcgcgacggctacggccagaccgag
accaccgcccagatcggcaacacccccggccagcccgtcaaacccggctcgatgggccgc
ccgctgcccggctaccaggtcaccctcgtcgacccggtcaccggcgaggagatcaccgga
accggcgtcgacggcgaactctgcctgcccctggtctccgcccccctcggcctgatgacc
ggctaccaggacgaccccgaacgccacgccgagtcgatggccggcggccgctaccacacc
ggcgacgtcgcccagcgcgacgccgacggctactacaccttcgtcggccgcgccgacgac
gtgttcaagagcagcgactaccggctctccccgttcgagctggagagcgtgctgatcgag
cacccggcggtggccgaggccgccgtcgtcccctccccggacccgctgcggctctccgtg
cccaaggcgtacgtcatcctcgcccccggccacgagccggacgccgcgaccgcgcggtcc
atcctggccttcacccgcaagcggctcgccccgtacaagcggatccgccgcctggagttc
gccgacctgccgaagaccatctccggcaagatccgccgcatcgagctgcgcggccgggag
cgggaacgccacggcgaggcggagccgctcgccgcacgcccgcgcggcgagcgcgagttc
tgggaggaggacttccccggcctcaaggacgcctga

DBGET integrated database retrieval system