KEGG   Kitasatospora setae: KSE_66420Help
Entry
KSE_66420         CDS       T01648                                 

Gene name
adh
Definition
putative alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ksk  Kitasatospora setae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KSE_66420 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_66420 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    KSE_66420 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    KSE_66420 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KSE_66420 (adh)
   00626 Naphthalene degradation
    KSE_66420 (adh)
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KSE_66420 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7490309..7491322
Genome map
AA seq 337 aa AA seqDB search
MKAAVVRDFTKPLEIEEREVPSPEPHQVLVRIECSGLCHTDIHAAHGDWPVKPSPPFVPG
HEGVGIVEAAGDQVRHVKVGERVAIPWLADACGRCDFCVTGWETLCLSQHNSGYSVDGAY
AQYALAHGDYVVPVPDGVDPMDAAPLSCAGVTTYKAVKLAGARPGTRVLISGIGGLGHLA
LQYARIFGAETVAVDITDEKLKLAEELGADHVIDARTQDVAHEVQKLGGADAAVSLAVSN
ASFRAAYDSLRRGGTLVLVALPAEGELTLPVFDTVLNGTKVIGSIVGTRQDLAEVFRLHQ
LGRTKVIRETRKLEDVNTCFDEVLGGKVSARLVFDMR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagccgtcgtccgggacttcaccaagccgctggagatcgaggagcgcgaggtg
ccgtccccggagccgcaccaggtgctggtgcggatcgagtgctccggcctgtgccacacc
gacatccacgccgcgcacggcgactggccggtcaagccgtccccgccgttcgtgcccggc
cacgagggcgtgggcatcgtggaggcggccggcgaccaggtccggcacgtcaaggtcggc
gagcgggtggcgatcccgtggctggccgacgcctgcggccggtgcgacttctgcgtgacc
ggctgggagacgctctgcctcagccagcacaactccggctactcggtggacggcgcgtac
gcccagtacgcgctggcgcacggcgactacgtcgtcccggtgccggacggcgtcgacccg
atggacgccgccccgctgtcctgcgcgggcgtcaccacctacaaggcggtcaagctcgcc
ggcgcccggccgggcacccgggtgctgatctccggcatcggcggcctcggccacctggcg
ctgcagtacgcccggatcttcggcgccgagacggtcgccgtcgacatcaccgacgagaag
ctcaagctggccgaggaactcggcgccgaccacgtcatcgacgcccgcacccaggacgtc
gcgcacgaggtgcagaagctcggcggcgcggacgcggcggtctcgctggccgtctccaac
gcgtcgttccgggccgcctacgactcgctgcgccgcggcggcacgctcgtcctggtcgcc
ctgcccgccgagggcgagctgaccctgccggtgttcgacacggtgctgaacgggacgaag
gtgatcggctcgatcgtcggcacccggcaggacctggccgaggtgttccggctgcaccag
ctgggccggacgaaggtgatccgggagacccgcaagctggaggacgtcaacacctgcttc
gacgaggtgctgggcggcaaggtctcggcccgactggtgttcgacatgcgctga

DBGET integrated database retrieval system