KEGG   Kitasatospora setae: KSE_67070Help
Entry
KSE_67070         CDS       T01648                                 

Definition
putative hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ksk  Kitasatospora setae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ksk00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ksk00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ksk00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7564189..7565988
Genome map
AA seq 599 aa AA seqDB search
MVVNAALSWDGSAPPSGRTETSRTVDAGPLALRVTAIGSDAEPAVTVTESDGTPGVLVIE
AATATPDARLRIEWQLPCTGATGYWTPHTNSRWLPPSWALPREASLPKGAPVGSLVGAGD
AALCTFAVGELVRPVTIGEGAVEETGRYSWWVEQDGPRIALRLDLSGRHFADTVRESAAW
WGTLAPVRDVPDAAFDPIFCTWYALHLAMTSADVERLAELAAPLGFRSLIVDDGWQTDER
TRSYATTGDWQPAPHDFPDFAGHVRRIQALGLNYLLWHAIPFVGDRSGAAKRLEGHTLTH
LPLLETFLLDPRSPGVRAHQVERLAAAVEQHGVDGLKVDFVDTFARKPAPGAAPNTASPE
ADCETVAEGVQKLLAELDTRLRATRPDVLVEHRQDYMGPGLWPYATMVRATDCPHNAVEN
RVRTADLRLTAGPLAVHADPLTWHPEESPEQIAVLLQSVLFATAQVSVDLAAQNADQLTA
LAFWLSVMKEHRDLLQRSELRPHRPELAYPVIEARDGARLAFGRYAPLPLRAHGEWELLL
VANADQDTLVRIEFDRAPGTVDLLVQDSLGGTVARAQTPVGGTELSVRVPTGGLLTLRA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtggtagtcaacgccgcgctgtcctgggacggctccgcaccgccgtccggccgcaccgag
acctcccgcaccgtcgacgccgggccgctcgccctgcgggtcaccgccatcggcagcgac
gccgaaccggccgtcaccgtcaccgagtccgacggcacccccggcgtgctggtgatcgag
gccgccaccgccaccccggacgcccggctgcggatcgagtggcagctgccctgcaccggc
gccaccggctactggacgccccacaccaactcccgctggctgcccccgagctgggccctg
ccccgggaagcctcgctgcccaagggcgcccccgtcggcagcctggtcggcgccggcgac
gccgccctgtgcaccttcgcggtcggcgaactcgtccgccccgtcaccatcggcgagggc
gccgtcgaggagaccggccgctacagctggtgggtcgagcaggacggcccgcggatcgcc
ctccgcctcgacctgagcggacgccacttcgccgacaccgtacgggagtcggccgcctgg
tggggcaccctcgccccggtccgcgacgtccccgacgccgcgttcgacccgatcttctgc
acctggtacgccctgcacctggcgatgacctccgccgacgtcgagcggctcgccgaactc
gccgccccgctcggcttccgctcgctgatcgtcgacgacggctggcagaccgacgagcgc
acccgctcctacgccaccaccggcgactggcagcccgccccgcacgacttccccgacttc
gccgggcacgtccgccggatccaggccctcggcctcaactacctgctctggcacgcgatc
ccgttcgtcggcgaccgcagcggcgccgccaagcggctggagggccacaccctcacccac
ctgccgctgctggagaccttcctgctcgacccgcgcagccccggcgtccgcgcccaccag
gtcgagcggctcgccgccgccgtcgaacagcacggcgtcgacggcctcaaggtcgacttc
gtcgacaccttcgcccgcaagcccgcgcccggcgccgcgcccaacaccgcctccccggaa
gcggactgcgagaccgtcgccgagggcgtgcagaagctgctcgccgaactcgacacccgg
ctgcgggccacccggcccgacgtcctggtcgagcaccgccaggactacatgggccccggc
ctgtggccctacgccaccatggtccgggccaccgactgcccgcacaacgcggtcgagaac
cgcgtccgcaccgccgacctgcggctcaccgccggcccgctcgccgtgcacgccgacccg
ctgacctggcaccccgaggagagcccggagcagatcgccgtcctgctccagtcggtgctc
ttcgccaccgcccaggtctccgtcgacctggccgcccagaacgccgaccagctgaccgcg
ctggcgttctggctgagcgtcatgaaggagcaccgcgacctgctccagcgctccgaactg
cgcccgcaccggcccgagttggcctaccccgtgatcgaggcccgggacggcgcccgactg
gccttcggccgctacgcgccgctgccgctgcgggcccacggcgagtgggagctgttgctg
gtcgccaacgccgaccaggacaccctggtccggatcgagttcgaccgcgcccccggcacc
gtcgacctgctggtgcaggacagcctcggcggcaccgtcgcccgggcgcagaccccggtc
ggcgggacggagctctccgtccgcgtccccaccgggggtctgctcaccctgcgcgcctga

DBGET integrated database retrieval system