KEGG   Kitasatospora setae: KSE_67260Help
Entry
KSE_67260         CDS       T01648                                 

Definition
putative glycoside hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ksk  Kitasatospora setae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ksk00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ksk00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7587335..7589215
Genome map
AA seq 626 aa AA seqDB search
MYRRALGAAAALVLAATGLATVGGTAARAADTTAQVWITTADGASRLAPAASAAFSATAP
QAQDIAVGAGDVRQPLVGFGAAFTESSAHLVAGLPAATRSALMNDLFATSGGGIGLNYLR
QPLGASDFVAHLPFYSYEDTRGAFSIARDQQEILPAIAQARAVNPNIRIMGTPWSPPAWM
KTSNSLNGGSLKPENYGDFADYLVKAVQAYGAAGAPISDLTVANEPKFQTTYPSTGMTAA
QQADFVKVLDGRLTAAGLPTELYAYDHNWDDAGFPLAVLSQDASVARLKGAAFHCYGGQP
EAEQQVADTGKAVFFTECTGTDAATPAQTFAGTLKWQTENLVIRNLRSGGRTAVLWNIAL
DANGGPQYGNCSTTCNGVLEIANGTYTKNAEYYVLGHISRFAKPGAHRIGSTSQGSGGLQ
DVAFLNPDGSRGAVVLNATGSAQHFSISDGGRSLVYDLPAGAVATFTWPGAPTGGGSGGT
VDSAAWYALANANSGKCVDATGWGTANGTAVQQWACGTGANQQWQFTPTDSGYYRVTNRN
AAAGAQVLDVTAAATADGAKLQTWQWSGGANQQFRPVRQADGTWTLVNRNSGKCLDVTDV
STADGARLQQWACTGGAAQSFRLTPQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgacgcgctctcggcgccgccgccgccctcgtgctggccgccaccggcctggcc
accgtcggcggaacggccgcccgggcggccgacaccaccgcccaggtctggatcaccacc
gccgacggcgccagccgcctcgccccggccgcctccgccgcgttctccgccaccgccccg
caggcgcaggacatcgcggtcggcgcgggcgacgtccggcagccgctggtcggtttcggc
gccgcgttcaccgagtcctccgcccacctggtggccgggctgcccgccgcgacccggtcg
gcgctgatgaacgacctgttcgcgacctcgggcggcggcatcggcctgaactacctgcgc
cagccgctcggtgcctccgacttcgtcgcgcacctgccgttctactcgtacgaggacacc
aggggcgcgttctcgatcgcccgcgaccagcaggagatcctccccgcgatcgcccaggcc
cgcgcggtcaacccgaacatccggatcatgggcaccccgtggtcgccgcccgcctggatg
aagacctcgaactcgctgaacggcggcagcctgaagccggagaactacggcgacttcgcc
gactacctggtcaaggcggtccaggcgtacggtgcggccggcgccccgatcagcgacctg
acggtggccaacgagccgaagttccagaccacctacccgtccaccgggatgacggccgcc
cagcaggccgacttcgtcaaggtgctggacggcaggctgaccgcggccggcctgcccacc
gagctctacgcgtacgaccacaactgggacgacgccgggttcccgctcgccgtgctctcc
caggacgcctcggtggcccggctcaagggcgcggcgttccactgctacggcgggcagccg
gaggcggagcagcaggtcgcggacaccgggaaggcggtgttcttcaccgagtgcaccggc
accgacgcggccaccccggcgcagaccttcgccggcacgctgaagtggcagaccgagaac
ctggtcatccgcaacctgcgcagcggcggccgcaccgccgtgctgtggaacatcgcgctg
gacgccaacggcggcccgcagtacggcaactgctcgaccacctgcaacggcgtgctggag
atcgccaacggcacgtacaccaagaacgccgagtactacgtgctcggccacatctccagg
ttcgccaagccgggcgcgcaccggatcggctcgaccagccagggcagcggcggcctgcag
gacgtcgccttcctgaacccggacggctcgcgcggcgcggtggtgctcaacgcgaccggc
tccgcccagcacttctcgatcagcgacggcggccgctccctggtctacgacctcccggcc
ggcgcggtcgccaccttcacctggcccggcgcccccaccggcggcggcagcggcgggacg
gtcgacagcgcggcctggtacgcgctggccaacgccaactccggcaagtgcgtggacgcc
accggctggggcaccgccaacggcaccgccgtccagcagtgggcctgcggcaccggggcc
aaccagcagtggcagttcacccccaccgacagcggctactaccgggtcaccaaccgcaac
gccgccgccggcgcccaggtgctggacgtcaccgccgccgccaccgccgacggcgccaag
ctccagacctggcagtggtccggcggcgccaaccagcagttcaggccggtccggcaggcc
gacggcacctggacgctggtcaaccgcaacagcggcaagtgtctggacgtcaccgacgtc
tccaccgcggacggcgcccgcctccagcagtgggcctgcaccggcggcgcggcccagtcc
ttccgcctcaccccgcagtag

DBGET integrated database retrieval system