KEGG   Kitasatospora setae: KSE_67260Help
Entry
KSE_67260         CDS       T01648                                 

Definition
putative glycoside hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ksk  Kitasatospora setae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    KSE_67260
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    KSE_67260
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     KSE_67260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7587335..7589215
Genome map
AA seq 626 aa AA seqDB search
MYRRALGAAAALVLAATGLATVGGTAARAADTTAQVWITTADGASRLAPAASAAFSATAP
QAQDIAVGAGDVRQPLVGFGAAFTESSAHLVAGLPAATRSALMNDLFATSGGGIGLNYLR
QPLGASDFVAHLPFYSYEDTRGAFSIARDQQEILPAIAQARAVNPNIRIMGTPWSPPAWM
KTSNSLNGGSLKPENYGDFADYLVKAVQAYGAAGAPISDLTVANEPKFQTTYPSTGMTAA
QQADFVKVLDGRLTAAGLPTELYAYDHNWDDAGFPLAVLSQDASVARLKGAAFHCYGGQP
EAEQQVADTGKAVFFTECTGTDAATPAQTFAGTLKWQTENLVIRNLRSGGRTAVLWNIAL
DANGGPQYGNCSTTCNGVLEIANGTYTKNAEYYVLGHISRFAKPGAHRIGSTSQGSGGLQ
DVAFLNPDGSRGAVVLNATGSAQHFSISDGGRSLVYDLPAGAVATFTWPGAPTGGGSGGT
VDSAAWYALANANSGKCVDATGWGTANGTAVQQWACGTGANQQWQFTPTDSGYYRVTNRN
AAAGAQVLDVTAAATADGAKLQTWQWSGGANQQFRPVRQADGTWTLVNRNSGKCLDVTDV
STADGARLQQWACTGGAAQSFRLTPQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgacgcgctctcggcgccgccgccgccctcgtgctggccgccaccggcctggcc
accgtcggcggaacggccgcccgggcggccgacaccaccgcccaggtctggatcaccacc
gccgacggcgccagccgcctcgccccggccgcctccgccgcgttctccgccaccgccccg
caggcgcaggacatcgcggtcggcgcgggcgacgtccggcagccgctggtcggtttcggc
gccgcgttcaccgagtcctccgcccacctggtggccgggctgcccgccgcgacccggtcg
gcgctgatgaacgacctgttcgcgacctcgggcggcggcatcggcctgaactacctgcgc
cagccgctcggtgcctccgacttcgtcgcgcacctgccgttctactcgtacgaggacacc
aggggcgcgttctcgatcgcccgcgaccagcaggagatcctccccgcgatcgcccaggcc
cgcgcggtcaacccgaacatccggatcatgggcaccccgtggtcgccgcccgcctggatg
aagacctcgaactcgctgaacggcggcagcctgaagccggagaactacggcgacttcgcc
gactacctggtcaaggcggtccaggcgtacggtgcggccggcgccccgatcagcgacctg
acggtggccaacgagccgaagttccagaccacctacccgtccaccgggatgacggccgcc
cagcaggccgacttcgtcaaggtgctggacggcaggctgaccgcggccggcctgcccacc
gagctctacgcgtacgaccacaactgggacgacgccgggttcccgctcgccgtgctctcc
caggacgcctcggtggcccggctcaagggcgcggcgttccactgctacggcgggcagccg
gaggcggagcagcaggtcgcggacaccgggaaggcggtgttcttcaccgagtgcaccggc
accgacgcggccaccccggcgcagaccttcgccggcacgctgaagtggcagaccgagaac
ctggtcatccgcaacctgcgcagcggcggccgcaccgccgtgctgtggaacatcgcgctg
gacgccaacggcggcccgcagtacggcaactgctcgaccacctgcaacggcgtgctggag
atcgccaacggcacgtacaccaagaacgccgagtactacgtgctcggccacatctccagg
ttcgccaagccgggcgcgcaccggatcggctcgaccagccagggcagcggcggcctgcag
gacgtcgccttcctgaacccggacggctcgcgcggcgcggtggtgctcaacgcgaccggc
tccgcccagcacttctcgatcagcgacggcggccgctccctggtctacgacctcccggcc
ggcgcggtcgccaccttcacctggcccggcgcccccaccggcggcggcagcggcgggacg
gtcgacagcgcggcctggtacgcgctggccaacgccaactccggcaagtgcgtggacgcc
accggctggggcaccgccaacggcaccgccgtccagcagtgggcctgcggcaccggggcc
aaccagcagtggcagttcacccccaccgacagcggctactaccgggtcaccaaccgcaac
gccgccgccggcgcccaggtgctggacgtcaccgccgccgccaccgccgacggcgccaag
ctccagacctggcagtggtccggcggcgccaaccagcagttcaggccggtccggcaggcc
gacggcacctggacgctggtcaaccgcaacagcggcaagtgtctggacgtcaccgacgtc
tccaccgcggacggcgcccgcctccagcagtgggcctgcaccggcggcgcggcccagtcc
ttccgcctcaccccgcagtag

DBGET integrated database retrieval system