KEGG   Kitasatospora setae: KSE_73960Help
Entry
KSE_73960         CDS       T01648                                 

Definition
putative endo-1,4-beta-xylanase precursor
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ksk  Kitasatospora setae
Brite
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     KSE_73960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(8456268..8457434)
Genome map
AA seq 388 aa AA seqDB search
MKLRRTLVAAAAAAVVLPLVPSAVAAAAPEKKPAPAADSLRALGDRQKLGIGTAVDDAHL
GSDQPYTDLVAGQFSVVTPENAMKWESVEPTRGSYDWAAADRLVAFAGEHGQQVRGHTLL
WHNQLPSWLTGGVADGGISKDQLREILRKHVTDEVTHFRGRIWQWDVANEVFANAWDPNP
LPNGLNGDDFWIRNLGEGVVADVFRWAHQADPKALLFYNDYNIAGQDGSNAKFQAVHDFF
GKLVAQGVPVDGIGEQGHLDTQYGFDGQRFQADLQAYADLGLKVAVTEADVRTFVDNATD
QVPTSQLAAFAQPYEFSQMLTACQLVDACVSFTAWGVYDGDSWIPGTFAGTGYGLLYDVN
MRPKPAYFTLRQDLALAAGDARHGGGRK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcttcgccgtacgctcgtggcggccgccgccgcggccgtcgtcctcccgctcgtc
ccgtccgccgtcgccgcggccgccccggagaagaagccggcccccgccgccgactcgctg
cgcgccctcggcgaccggcagaagctgggcatcggcaccgccgtcgacgacgcccacctg
ggcagcgaccagccgtacaccgacctggtcgccggccagttctccgtcgtgacgccggag
aacgcgatgaagtgggagtcggtggagccgacccgcggcagctacgactgggccgccgcc
gaccggctggtggcgttcgccggggagcacggccagcaggtccgcggccacaccctgctc
tggcacaaccagctgccgtcctggctgaccggtggcgtggccgacggcggcatcagcaag
gaccagctgcgcgagatcctgcgcaagcacgtcaccgacgaggtcacgcacttccggggc
aggatctggcagtgggacgtcgccaacgaggtcttcgccaacgcctgggacccgaacccg
ctgcccaacggcctcaacggcgacgacttctggatcaggaacctcggcgagggcgtcgtc
gccgacgtcttccgctgggcccaccaggccgacccgaaggccctgctcttctacaacgac
tacaacatcgccggccaggacggcagcaacgccaagttccaggccgtgcacgacttcttc
ggcaagctggtcgcccagggcgtgccggtcgacggcatcggcgagcagggccacctcgac
acccagtacggcttcgacgggcagcgcttccaggccgacctccaggcgtacgccgacctc
ggcctgaaggtcgccgtcaccgaggccgacgtgcgcaccttcgtcgacaacgccaccgac
caggtgccgaccagccagctcgccgcgttcgcccagccgtacgagttctcccagatgctg
acggcctgccagctcgtcgacgcctgcgtctcgttcaccgcgtggggcgtgtacgacggc
gactcgtggatccccggcaccttcgccggcaccggctacggcctgctctacgacgtcaac
atgcggccgaagcccgcctacttcaccctgcggcaggacctcgccctcgccgcgggcgac
gccaggcacggcggcggcaggaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system