KEGG   Kitasatospora setae: KSE_74180Help
Entry
KSE_74180         CDS       T01648                                 

Gene name
galM1
Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ksk  Kitasatospora setae
Pathway
ksk00010  Glycolysis / Gluconeogenesis
ksk00052  Galactose metabolism
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
Module
ksk_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_74180 (galM1)
   00052 Galactose metabolism
    KSE_74180 (galM1)
Enzymes [BR:ksk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     KSE_74180 (galM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAJ33173
NITE: KSE_74180
UniProt: E4NJM5
Position
8483595..8484677
Genome map
AA seq 360 aa AA seqDB search
MPPGAPARLRIAQSEIATLPDGRWITRWTFGAPGGVTAEVLSLGARLEALHAPDRSGHRT
NVVLGGAHVADLLGDAAYFGATVGRYANRVAGGRLPLDGTVHHLATQDTGHTLHGGPDGY
ATRLWEGEAVREEHRVGVRLRLHSPDGDQGFPGALTAETTYLLDARGELTIEYRATTDAP
TVVNLTNHAYFNLAGEGSGTVLDHLLRVDAAGYLPVDDDLIPLGPVEPVAGTPFDLRTAR
TLGDRFALRHPQLGPAGSGYDHTWVLDGTGLRTAAVLTDPASGRRLECRTTEPGLQVYTG
NLFDGSVTGRSGRPYRAHAGLALETQHFPDSPNRPDYPSTALRPGEEYRSTTVYRFTVTR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcccggagcccccgcccgactcaggatcgcccagagcgagatcgccaccctcccc
gacggccggtggatcacccgctggacgttcggcgcccccggcggcgtcaccgcggaggtc
ctcagcctcggcgcccgcctcgaagccctccacgcccccgaccgcagcggacaccgcacc
aacgtcgtcctcggcggcgcccacgtcgccgacctgctcggcgacgccgcctacttcggc
gccaccgtgggccgctacgccaaccgcgtcgccggcggccgactgcccctcgacggcacc
gtccaccacctcgccacccaggacaccggccacaccctgcacggcggccccgacggctac
gccacccggctctgggagggcgaagccgtccgcgaagagcaccgggtcggcgtccggctg
cgcctgcacagccccgacggcgaccagggcttccccggcgcgctcaccgccgagaccacc
tacctgctcgacgcccgcggcgaactgaccatcgagtaccgggccaccaccgacgcgccc
accgtcgtcaacctcaccaaccacgcctacttcaacctcgccggcgaaggcagcggcacc
gtcctcgaccacctgctgcgcgtcgacgccgccggctacctccccgtcgacgacgacctg
atcccgctcggcccggtcgaacccgtcgccggcacccccttcgacctccgcacggcccgc
acgctcggcgaccggttcgccctgcggcacccgcaactcggcccggccggctccggctac
gaccacacctgggtcctggacggcaccggcctgcgcaccgccgccgtcctcaccgacccg
gccagcggccgccgcctggagtgccgcaccaccgaacccggactccaggtctacaccggc
aacctcttcgacggctcggtcaccggccgctccggccgcccctaccgggcacacgccggc
ctcgccctggagacccagcacttccccgactccccgaaccgccccgactacccctccacc
gccctgcgcccgggggaggagtaccgctccaccacggtctaccggttcaccgtcacccgc
tga

DBGET integrated database retrieval system