KEGG   Kitasatospora setae: KSE_74590Help
Entry
KSE_74590         CDS       T01648                                 

Definition
putative peptide ABC transporter permease
Orthology
K02033  
peptide/nickel transport system permease protein
Organism
ksk  Kitasatospora setae
Module
Peptides/nickel transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(8521813..8522943)
Genome map
AA seq 376 aa AA seqDB search
MTLAQPLGGRAAEDDGNDPERGRPRRAALRGRLPLPRSPLVRYLAVRLLLVLPTVLLLLT
AVFFLMRATGDPITTAFADRLTPAQLQEKLHAAGYDRPLLTQYFDYLRQTATGDFGRTAT
DNRAVSEVLRTYGAATLELACWALLVAVAVGVPLGALAARFRDRAPDAVLRLAAVLAYAT
PVFFVGLLLKLVLAVGLGWLPVSGRASIDVELRLQDLSDPTGLYLLDAVRSGDGPAVADV
LRHAVLPALALGLLLAGVLLRLVRTHLISTLEAEYVEAARSRGVGGLRLVTRHAARPALI
PVVTVLGLQVAGLLGGAVLTETTFEWKGLGYELAHYLTARDFAAVQGIVALFAVVVAVVN
FLVDALAALIDPRVRY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgctcagcccctgggcggacgcgcggcggaggacgacggcaacgaccccgag
cgcggccggccccggcgggccgcgctccgggggcggctgccgctgccgcgttcaccgctg
gtccgctacctggcggtccgcctgctgctcgtcctgccgaccgtcctgctgctgctcacc
gccgtgttcttcctgatgcgggccaccggcgacccgatcaccaccgccttcgccgaccgg
ctcaccccggcccagttgcaggagaagctgcacgcggccggctacgaccggccgctgctc
acccagtacttcgactacctgcggcagaccgccaccggcgacttcggccgcaccgccacc
gacaaccgggcggtctccgaggtgctccgcacctacggcgccgccaccctcgaactcgcc
tgctgggccctgctggtggccgtcgccgtgggcgtcccgctgggcgccctggcggcccgc
ttccgcgaccgcgccccggacgcggtgctgcggctggccgccgtgctggcctacgccacc
ccggtgttcttcgtcggcctgctgctcaagctggtgctcgcggtcggcctgggctggctg
ccggtctccggccgcgcctcgatcgacgtcgagctgcgcctccaggacctctccgacccg
accggcctctacctgctggacgcggtgcgcagcggcgacggcccggccgtcgccgacgtg
ctgcggcacgccgtgctgcccgcgctggcgctgggcctgctgctggcgggcgtgctgctg
cggctggtccgcacccacctgatctccaccctggaggccgagtacgtcgaggcggcccgc
tcgcgcggggtcggcgggctgcggctggtcacccggcacgccgcccggcccgcgctgatc
ccggtggtgacggtgctcggcctccaggtggccgggctgctgggcggcgcggtgctgacc
gagaccaccttcgagtggaagggcctgggctacgagctggcgcactacctgacggcccgt
gacttcgccgccgtccagggcatcgtggcgctgttcgccgtggtggtcgcggtggtcaac
ttcctggtggacgcgctcgccgcgctgatcgacccccgggtgaggtactga

DBGET integrated database retrieval system