KEGG   Kitasatospora setae: KSE_74590Help
Entry
KSE_74590         CDS       T01648                                 

Definition
(GenBank) putative peptide ABC transporter permease protein
  KO
K02033  
peptide/nickel transport system permease protein
Organism
ksk  Kitasatospora setae
Module
Peptides/nickel transport system
Brite
Transporters [BR:ksk02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    KSE_74590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(8521813..8522943)
Genome map
AA seq 376 aa AA seqDB search
MTLAQPLGGRAAEDDGNDPERGRPRRAALRGRLPLPRSPLVRYLAVRLLLVLPTVLLLLT
AVFFLMRATGDPITTAFADRLTPAQLQEKLHAAGYDRPLLTQYFDYLRQTATGDFGRTAT
DNRAVSEVLRTYGAATLELACWALLVAVAVGVPLGALAARFRDRAPDAVLRLAAVLAYAT
PVFFVGLLLKLVLAVGLGWLPVSGRASIDVELRLQDLSDPTGLYLLDAVRSGDGPAVADV
LRHAVLPALALGLLLAGVLLRLVRTHLISTLEAEYVEAARSRGVGGLRLVTRHAARPALI
PVVTVLGLQVAGLLGGAVLTETTFEWKGLGYELAHYLTARDFAAVQGIVALFAVVVAVVN
FLVDALAALIDPRVRY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgctcagcccctgggcggacgcgcggcggaggacgacggcaacgaccccgag
cgcggccggccccggcgggccgcgctccgggggcggctgccgctgccgcgttcaccgctg
gtccgctacctggcggtccgcctgctgctcgtcctgccgaccgtcctgctgctgctcacc
gccgtgttcttcctgatgcgggccaccggcgacccgatcaccaccgccttcgccgaccgg
ctcaccccggcccagttgcaggagaagctgcacgcggccggctacgaccggccgctgctc
acccagtacttcgactacctgcggcagaccgccaccggcgacttcggccgcaccgccacc
gacaaccgggcggtctccgaggtgctccgcacctacggcgccgccaccctcgaactcgcc
tgctgggccctgctggtggccgtcgccgtgggcgtcccgctgggcgccctggcggcccgc
ttccgcgaccgcgccccggacgcggtgctgcggctggccgccgtgctggcctacgccacc
ccggtgttcttcgtcggcctgctgctcaagctggtgctcgcggtcggcctgggctggctg
ccggtctccggccgcgcctcgatcgacgtcgagctgcgcctccaggacctctccgacccg
accggcctctacctgctggacgcggtgcgcagcggcgacggcccggccgtcgccgacgtg
ctgcggcacgccgtgctgcccgcgctggcgctgggcctgctgctggcgggcgtgctgctg
cggctggtccgcacccacctgatctccaccctggaggccgagtacgtcgaggcggcccgc
tcgcgcggggtcggcgggctgcggctggtcacccggcacgccgcccggcccgcgctgatc
ccggtggtgacggtgctcggcctccaggtggccgggctgctgggcggcgcggtgctgacc
gagaccaccttcgagtggaagggcctgggctacgagctggcgcactacctgacggcccgt
gacttcgccgccgtccagggcatcgtggcgctgttcgccgtggtggtcgcggtggtcaac
ttcctggtggacgcgctcgccgcgctgatcgacccccgggtgaggtactga

DBGET integrated database retrieval system