KEGG   Kitasatospora setae: KSE_74630Help
Entry
KSE_74630         CDS       T01648                                 

Gene name
phoD
Definition
putative alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ksk  Kitasatospora setae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ksk00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ksk00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ksk02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
8527451..8529103
Genome map
AA seq 550 aa AA seqDB search
MTTPTSTAAPRPPRRRVIQAAALTAGALALPLTAAGQAGAADTPRFLHGVASGDPLPDGV
LLWTRLTPTADAAPGSGLGPDTPVRWQLATDRDFTTLAATGTVTTSAATDHTVKADVRGL
RPDTAYWYRFLADGVTSPVGRTRTTPAADATTDRLRLGVASCANWEAGHFAAYRHLAARG
DLDAFLFLGDYIYEYASGAYAARGTVVRPHAPAHEILTLADYRTRHGRYKTDPDLQALHA
AVPTIAIWDDHEFANDAWSGGAENHTPGTEGDWAARVAAAKQAYFEWMPVRPSVAGTTYR
RLRYGKLADLHLLDLRSFRSRQAAIGDGAVDSADRTLTGRAQLDWLKAGLAASDTTWRLV
GNEVMISPVAFLALPDYLLRPLAQLLGLPGEGLAVNVDQWDGYTHDRRELLGHLKDHHIT
NTVFLTGDIHSAWACDVPHEAATYPASGSAATEFVVTSVTSDNIDDILKVAPGTLSLAAA
AAIQAANPHVKWTDLDSHGYGVLDITADRAQMDYYVLSDRTKADATTRWTRSYRTRTGTQ
QVERVHAPVT
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacacccaccagcaccgccgcgccccgcccgccgcgccgccgggtcatccaggcc
gccgccctcaccgccggggccctcgcgctgccgctcaccgccgccggccaggccggcgcc
gccgacaccccgcgcttcctgcacggcgtcgcctccggcgacccgctgcccgacggcgtc
ctgctgtggacccggctcacccccaccgccgacgccgcccccggctccggactcggcccc
gacacccccgtccgctggcaactcgccaccgaccgcgacttcaccaccctcgccgccacc
ggcaccgtcaccaccagcgccgccaccgaccacaccgtcaaggccgacgtccgcggcctg
cgccccgacaccgcctactggtaccgcttcctcgccgacggcgtcacctcccccgtcggc
cgcacccgcaccacccccgccgccgacgccaccaccgaccggctgcgcctgggcgtcgcc
tcctgcgccaactgggaggccggccacttcgccgcctaccgccacctcgccgcccgcggc
gacctcgacgccttcctcttcctcggcgactacatctacgagtacgccagcggcgcctac
gccgcccgcggcaccgtcgtacgcccgcacgcccccgcccacgagatcctcaccctcgcc
gactaccgcacccggcacggccgctacaagaccgaccccgacctccaggccctgcacgcc
gccgtccccaccatcgccatctgggacgaccacgagttcgccaacgacgcctggtccggc
ggcgccgagaaccacacccccggcaccgagggcgactgggccgcccgggtcgccgccgcc
aagcaggcctacttcgagtggatgccggtccgcccgtccgtcgccggcaccacctaccgg
cggctgcgctacggcaagctcgccgacctgcacctgctcgacctgcgctccttccgctcc
cggcaggctgccatcggcgacggcgccgtcgactccgccgaccgcaccctcaccggccgg
gcccaactcgactggctgaaggccggactcgccgcctccgacaccacctggcggctggtc
ggcaacgaggtgatgatctcccccgtcgcgttcctggccctccccgactacctgctgcgc
ccgctcgcccaactgctcggcctgcccggcgagggcctcgccgtcaacgtcgaccagtgg
gacggctacacccacgaccggcgcgaactgctcggccacctcaaggaccaccacatcacc
aacaccgtcttcctcaccggcgacatccactccgcctgggcctgcgacgtcccccacgag
gccgccacctaccccgcctccggcagcgccgccaccgagttcgtcgtcacctccgtcacc
agcgacaacatcgacgacatcctcaaggtcgcccccggcaccctctccctggccgccgcc
gccgcgatccaggccgccaacccgcacgtcaagtggaccgacctcgactcgcacggctac
ggcgtcctcgacatcaccgccgaccgcgcccagatggactactacgtcctctccgaccgc
accaaggccgacgccaccacccgctggacccgctcctaccgcacccgcaccggcacccag
caggtcgaacgcgtccacgccccggtcacctga

DBGET integrated database retrieval system