KEGG   Kitasatospora setae: KSE_75760tHelp
Entry
KSE_75760t        CDS       T01648                                 

Definition
(GenBank) putative mannose-1-phosphate guanyltransferase
  KO
K16881  
mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
ksk  Kitasatospora setae
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KSE_75760t
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_75760t
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     KSE_75760t
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     KSE_75760t
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(8667199..8669694)
Genome map
AA seq 831 aa AA seqDB search
MKAVVMAGGEGTRLRPMTSDLPKPLLPVADRPIMEHVLRLLRRHGLRETVVTVQFLAPLV
QEQFGDGSALGMSLTYAREDSPLGTAGSVKNAQEQLGGAPFVVISGDALTDIDLGDLIRF
HREKGALVTVCLTRVPDPLEFGITITDDQGRVERFLEKPTWGQVFSDTVNTGIYVMEPQV
LDHVAAGESVDWAGDVFPRLLAQGHPVYGYVAEGYWEDVGTHGSYLKAQADVLEGRVRVD
LPGFEVAPGVRVAATAQVDPAAVLEGPLYIGAHAQVGAGARLGQHTVVGSHAVIEQGAVL
QRAVVHPHAYVGPRAALRGAVVGRGAVLHSGTRVEEGAVLGSGCVLEEDSCVTGGVLVYP
GKSVEAGTVVSDCLIWDSRRAKSVFGSRGVRGTLNTEITTELAVRLAGAYATTLSLGAHV
AIARDHGTPAQVLAPAMICALRAAGVGVRDLGHVPLPVARRESAAGCDGAIVVTTTPGTP
ESVDIVFLGADGTDLPQGAQRALDRVFGRREYRRVLAGELGCLNTSPASVEDYARELAER
VDVSAIAERRLKVVVDAACGSAALVLPSVLGRIGVEALTVNSGLMPSACTQTASERAAAM
RTLGHLVAASRAAFGVRFDSAGERLWIVDELGREVGDDAALLLMVRLVTAELGGGTVALP
VTASRVAESAAAAHGGRIRWTATAPGELARRAAQDAAVLAADGEGAFILPEFSPHADGIA
AFVRLAGLLARDGAPLSELLSSLPRAHVRSRDLPTAWQDKGQVMRTVVEAASGRAIDTTD
GVRVLEDDGRWALVLPDSVSAVTRLWAEGPDPASADALLDEWCEAVGQPIA
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgttgtgatggcgggcggtgaggggacacggctgcggccgatgacctccgac
ctgcccaagccgctgcttcccgtcgccgaccgtcccatcatggagcacgtgctgcggctg
ctgcgcaggcacggcctgcgcgagacggtggtgaccgtccagttcctggccccgctcgtc
caggagcagttcggggacggctccgcgctcgggatgtcactgacctacgcgcgggaggac
agcccgctgggcaccgccggcagcgtgaagaacgcccaggagcagctgggcggcgccccg
ttcgtcgtcatatcgggcgacgcgctgaccgacatcgacctcggcgacctgatccggttc
caccgggagaagggcgccctggtcaccgtgtgcctcacccgggtccccgacccgctggag
ttcggcatcaccatcaccgacgaccagggccgggtggagcgcttcctggagaagcccacc
tgggggcaggtgttctcggacaccgtcaacacgggcatctacgtgatggagccgcaggtc
ctggaccacgtggccgccggggagagcgtcgactgggccggcgacgtgttcccccggctg
ctggcgcagggccacccggtgtacgggtacgtggccgagggctactgggaggacgtcggc
acccacggcagctacctgaaggcccaggccgacgtcctggagggacgcgtgcgggtggac
ctgcccggcttcgaggtcgcccccggcgtgcgggtggccgccaccgcccaggtcgacccg
gcggccgtcctggaggggccgctctacatcggcgcccacgcccaggtcggcgccggggcc
cggctgggccagcacacggtggtcggcagccacgccgtcatcgagcagggcgccgtcctg
cagcgcgccgtggtgcacccgcacgcctacgtcggcccgcgcgccgccctgcgcggcgcg
gtcgtggggcgcggcgccgtcctgcacagcggcacccgcgtcgaggagggcgccgtcctg
gggtccggctgcgtgctggaggaggactcctgcgtcacggggggcgtcctcgtctacccg
ggcaagagcgtcgaggcgggcaccgtcgtcagcgactgcctgatctgggactcccgccgc
gcgaagtccgtgttcggctcccgcggcgtgcgcggcacgctgaacaccgagatcaccacc
gaactcgcggtccgcctggccggcgcgtacgccacgaccctgtccctgggcgcccacgtg
gccatcgcccgcgaccacggcacacccgcgcaggtcctggcacccgcgatgatctgcgcg
ctgcgcgccgccggcgtcggggtgcgggacctggggcacgtgccgctgcccgtcgcccgc
cgcgagagcgccgccggctgcgacggcgcgatcgtggtgaccaccacgccgggcacgccc
gagagcgtcgacatcgtgttcctcggcgcggacggcaccgacctgccgcagggcgcgcag
cgcgccctggaccgcgtcttcgggcgccgggagtaccggcgggtgctggccggggagctg
ggctgcctgaacacctcgcccgcgtcggtggaggactacgcgcgcgaactcgccgagcgc
gtcgacgtgtccgcgatcgccgaacggcggctgaaagtggtcgtcgacgccgcgtgcggg
agcgccgcgctcgtcctgccctcggtcctgggacgcatcggcgtcgaggcgctcaccgtc
aacagcggcctgatgccgtcggcgtgcacgcagacggcctcggagcgcgccgccgccatg
cgcaccctgggccatctggtcgccgcctcccgcgcggcgttcggcgtgcgcttcgactcc
gcgggcgaacgcctgtggatcgtcgacgaactcggccgggaggtcggcgacgacgccgcg
ctgctgctgatggtgcgactggtcacggccgaactcggcggcggcaccgtcgcgctgccg
gtcaccgccagccgggtcgcggagtccgcggccgccgcgcacgggggacggatccggtgg
accgccaccgcccccggggagctcgcccgccgcgccgcccaggacgcggccgtgctggcc
gccgacggcgagggcgcgttcatcctgccggagttctccccgcacgccgacggcatcgcc
gcgttcgtacgcctggccggactgctcgcccgcgacggcgcgccgctgagcgaactcctc
tcgtcactgccgcgggcccacgtccgcagccgggacctgcccacggcctggcaggacaag
ggccaggtcatgcggacggtggtggaggcggccagcggacgcgccatcgacaccaccgac
ggagtacgggtcctggaggacgacggacggtgggcactggtcctgcccgactccgtctcc
gccgtcacccgcctgtgggccgaaggccccgaccccgcgtccgcggacgcgctcctggac
gaatggtgcgaagccgtgggccagcccatcgcctga

DBGET integrated database retrieval system