KEGG   Kitasatospora setae: KSE_75760tHelp
Entry
KSE_75760t        CDS       T01648                                 

Definition
putative mannose-1-phosphate guanyltransferase
Organism
ksk  Kitasatospora setae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(8667199..8669694)
Genome map
AA seq 831 aa AA seqDB search
MKAVVMAGGEGTRLRPMTSDLPKPLLPVADRPIMEHVLRLLRRHGLRETVVTVQFLAPLV
QEQFGDGSALGMSLTYAREDSPLGTAGSVKNAQEQLGGAPFVVISGDALTDIDLGDLIRF
HREKGALVTVCLTRVPDPLEFGITITDDQGRVERFLEKPTWGQVFSDTVNTGIYVMEPQV
LDHVAAGESVDWAGDVFPRLLAQGHPVYGYVAEGYWEDVGTHGSYLKAQADVLEGRVRVD
LPGFEVAPGVRVAATAQVDPAAVLEGPLYIGAHAQVGAGARLGQHTVVGSHAVIEQGAVL
QRAVVHPHAYVGPRAALRGAVVGRGAVLHSGTRVEEGAVLGSGCVLEEDSCVTGGVLVYP
GKSVEAGTVVSDCLIWDSRRAKSVFGSRGVRGTLNTEITTELAVRLAGAYATTLSLGAHV
AIARDHGTPAQVLAPAMICALRAAGVGVRDLGHVPLPVARRESAAGCDGAIVVTTTPGTP
ESVDIVFLGADGTDLPQGAQRALDRVFGRREYRRVLAGELGCLNTSPASVEDYARELAER
VDVSAIAERRLKVVVDAACGSAALVLPSVLGRIGVEALTVNSGLMPSACTQTASERAAAM
RTLGHLVAASRAAFGVRFDSAGERLWIVDELGREVGDDAALLLMVRLVTAELGGGTVALP
VTASRVAESAAAAHGGRIRWTATAPGELARRAAQDAAVLAADGEGAFILPEFSPHADGIA
AFVRLAGLLARDGAPLSELLSSLPRAHVRSRDLPTAWQDKGQVMRTVVEAASGRAIDTTD
GVRVLEDDGRWALVLPDSVSAVTRLWAEGPDPASADALLDEWCEAVGQPIA
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgttgtgatggcgggcggtgaggggacacggctgcggccgatgacctccgac
ctgcccaagccgctgcttcccgtcgccgaccgtcccatcatggagcacgtgctgcggctg
ctgcgcaggcacggcctgcgcgagacggtggtgaccgtccagttcctggccccgctcgtc
caggagcagttcggggacggctccgcgctcgggatgtcactgacctacgcgcgggaggac
agcccgctgggcaccgccggcagcgtgaagaacgcccaggagcagctgggcggcgccccg
ttcgtcgtcatatcgggcgacgcgctgaccgacatcgacctcggcgacctgatccggttc
caccgggagaagggcgccctggtcaccgtgtgcctcacccgggtccccgacccgctggag
ttcggcatcaccatcaccgacgaccagggccgggtggagcgcttcctggagaagcccacc
tgggggcaggtgttctcggacaccgtcaacacgggcatctacgtgatggagccgcaggtc
ctggaccacgtggccgccggggagagcgtcgactgggccggcgacgtgttcccccggctg
ctggcgcagggccacccggtgtacgggtacgtggccgagggctactgggaggacgtcggc
acccacggcagctacctgaaggcccaggccgacgtcctggagggacgcgtgcgggtggac
ctgcccggcttcgaggtcgcccccggcgtgcgggtggccgccaccgcccaggtcgacccg
gcggccgtcctggaggggccgctctacatcggcgcccacgcccaggtcggcgccggggcc
cggctgggccagcacacggtggtcggcagccacgccgtcatcgagcagggcgccgtcctg
cagcgcgccgtggtgcacccgcacgcctacgtcggcccgcgcgccgccctgcgcggcgcg
gtcgtggggcgcggcgccgtcctgcacagcggcacccgcgtcgaggagggcgccgtcctg
gggtccggctgcgtgctggaggaggactcctgcgtcacggggggcgtcctcgtctacccg
ggcaagagcgtcgaggcgggcaccgtcgtcagcgactgcctgatctgggactcccgccgc
gcgaagtccgtgttcggctcccgcggcgtgcgcggcacgctgaacaccgagatcaccacc
gaactcgcggtccgcctggccggcgcgtacgccacgaccctgtccctgggcgcccacgtg
gccatcgcccgcgaccacggcacacccgcgcaggtcctggcacccgcgatgatctgcgcg
ctgcgcgccgccggcgtcggggtgcgggacctggggcacgtgccgctgcccgtcgcccgc
cgcgagagcgccgccggctgcgacggcgcgatcgtggtgaccaccacgccgggcacgccc
gagagcgtcgacatcgtgttcctcggcgcggacggcaccgacctgccgcagggcgcgcag
cgcgccctggaccgcgtcttcgggcgccgggagtaccggcgggtgctggccggggagctg
ggctgcctgaacacctcgcccgcgtcggtggaggactacgcgcgcgaactcgccgagcgc
gtcgacgtgtccgcgatcgccgaacggcggctgaaagtggtcgtcgacgccgcgtgcggg
agcgccgcgctcgtcctgccctcggtcctgggacgcatcggcgtcgaggcgctcaccgtc
aacagcggcctgatgccgtcggcgtgcacgcagacggcctcggagcgcgccgccgccatg
cgcaccctgggccatctggtcgccgcctcccgcgcggcgttcggcgtgcgcttcgactcc
gcgggcgaacgcctgtggatcgtcgacgaactcggccgggaggtcggcgacgacgccgcg
ctgctgctgatggtgcgactggtcacggccgaactcggcggcggcaccgtcgcgctgccg
gtcaccgccagccgggtcgcggagtccgcggccgccgcgcacgggggacggatccggtgg
accgccaccgcccccggggagctcgcccgccgcgccgcccaggacgcggccgtgctggcc
gccgacggcgagggcgcgttcatcctgccggagttctccccgcacgccgacggcatcgcc
gcgttcgtacgcctggccggactgctcgcccgcgacggcgcgccgctgagcgaactcctc
tcgtcactgccgcgggcccacgtccgcagccgggacctgcccacggcctggcaggacaag
ggccaggtcatgcggacggtggtggaggcggccagcggacgcgccatcgacaccaccgac
ggagtacgggtcctggaggacgacggacggtgggcactggtcctgcccgactccgtctcc
gccgtcacccgcctgtgggccgaaggccccgaccccgcgtccgcggacgcgctcctggac
gaatggtgcgaagccgtgggccagcccatcgcctga

DBGET integrated database retrieval system