KEGG   Kitasatospora setae: KSE_75840tHelp
Entry
KSE_75840t        CDS       T01648                                 

Definition
(GenBank) putative acyltransferase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 Cation_efflux
Motif
Other DBs
NCBI-ProteinID: BAJ33337
NITE: KSE_75840t
UniProt: E4N410
Position
8678256..8679428
Genome map
AA seq 390 aa AA seqDB search
MAPAAAPPERLPSLTGTRFLAALLVLAFHASSEGLFADRGTAGVLAALLGKAGWAGVSFF
FVLSGFVLAWSAGPHGARPGFRRRRIARIHPAHLVTTLTAMALLVAGGTGLTWAEVVPNL
LLAQAWFPQPEIFVSGNPVSWSLSCELLFYLSFPPMWRALCRIRAGRLWWWAGALAAAVV
CVPPLAGHLLPGGPVLTMPDGTVTLHQYWFVYVLPPVRALEFVLGAVMARVVREGKWIGL
RPLPATALAAAGYAAATRVPYLYGLAAATVVPIALLVAALAHADRTGRRGWLAARPVVRL
GELSFALYLVHRLVLGYGHRALGADRGWSTPVAALLVLAALAVSLALAWLLHTLVEIPAL
RRWARPRPRPAPPRPHPAAPPGPAGHASPN
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcacccgcagccgccccaccggagcgattgccgtcactgaccggaacgcggtttctc
gccgccctcctcgtgctcgccttccacgcctcctccgaggggctgttcgccgaccggggc
accgccggggtcctggccgccctcctcgggaaggccggctgggcgggcgtctcgttcttc
ttcgtgctgagcggcttcgtgctggcctggtccgcgggcccgcacggggcgcggcccggt
ttccgccggcgcaggatcgccaggatccacccggcccatctcgtcaccaccctgacggcg
atggccctgctcgtggcgggcggcaccggcctcacctgggccgaggtggtgcccaacctg
ctgctcgcgcaggcctggttcccgcagccggagatcttcgtcagcgggaacccggtgagc
tggtcgctctcctgcgagctgctgttctacctgtccttcccgccgatgtggcgcgcgctg
tgccgcatcagggccggccggctgtggtggtgggcgggggcgctggccgcggccgtcgtg
tgcgtgccgccgctggccgggcacctgctgcccggcggcccggtgctgacgatgccggac
ggcaccgtcaccctccaccagtactggttcgtctacgtgctgccgccggtgcgcgccctg
gagttcgtcctgggagcggtgatggccagggtcgtgcgcgaggggaagtggatcggcctg
cggccgctgcccgccaccgccctcgccgccgccgggtacgcggcggcgacccgggtgccc
tacctctacggcctggcggccgccaccgtcgtgccgatcgccctgctggtcgcggcactc
gcccacgccgaccgtaccgggcgccgcggctggctcgccgcccgcccggtggtgcggctc
ggcgaactgtccttcgccctgtacctggtgcaccggctggtgctcggctacggccaccgg
gcgctgggcgccgaccgcggctggtccaccccggtggccgccctcctcgtactcgcggca
ctcgccgtcagcctcgccctggcctggctgctgcacaccctggtggagatccccgccctg
cgccgctgggcccgcccccgcccccgccccgcgccgccgcgcccgcatcccgccgcgccc
cccggccccgccggccacgcctcgccgaactga

DBGET integrated database retrieval system