KEGG   Kitasatospora setae: KSE_75890tHelp
Entry
KSE_75890t        CDS       T01648                                 

Gene name
galU3
Definition
putative UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ksk  Kitasatospora setae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KSE_75890t (galU3)
   00052 Galactose metabolism
    KSE_75890t (galU3)
   00500 Starch and sucrose metabolism
    KSE_75890t (galU3)
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_75890t (galU3)
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KSE_75890t (galU3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
8684083..8684997
Genome map
AA seq 304 aa AA seqDB search
MTSTSARIVKAVVPVAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVASGISDVLMV
TGRNKRPLEDHFDRNYELEAELLRKGDTDRLARVCAPTELADIHYVRQGDPRGLGHAVLC
AAPHVGSEPFAVLLGDDLIDPRDPLLSRMIEVREQHGGSVVALMEVDPSQIHLYGCAVVR
HDRDGDTVQVTDLVEKPAPGTAPSNYAVIGRYVLDPAVFEVLRRTEPGRGGEIQLTDALR
ELAHTNEGGPVHGVVFSGRRYDTGDRSDYLKATVRIAWEREDLGPEFRTWLREFMAADVL
APAH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacctccacgtctgcccgcatagtcaaggcagtggtacccgtcgccggtctcggaaca
cggttcctgccggccaccaaagccaccccgaaagaaatgctcccggtggtggacaaaccc
gcgatccagtacgtcgtcgaagaggccgtcgcctcggggatatccgacgtcctcatggtc
accggccgcaacaagcgcccgctggaggaccatttcgaccgcaactacgaactcgaggcc
gaactgctcagaaagggcgacaccgaccgcctcgcccgggtctgcgcccccaccgaactc
gcggacatccactacgtgcgccagggcgacccccggggcctgggacacgccgtcctgtgc
gcggccccccacgtcggctcggaacccttcgccgtcctgctcggcgacgacctcatcgac
ccccgcgaccccctgctgagccggatgatcgaggtccgcgagcagcacggcggcagcgtc
gtcgccctgatggaggtcgacccctcccagatccacctctacggctgcgccgtcgtgcgc
cacgaccgcgacggcgacaccgtccaggtcaccgacctggtggagaagcccgcgcccggc
accgccccgagcaactacgcggtgatcggccgctacgtgctggacccggcggtcttcgag
gtcctgcgccgcaccgagcccggccgcggcggcgagatccaactcaccgacgccctgcgc
gaactggcccacaccaacgagggcggcccggtgcacggcgtcgtcttctccggccggcgc
tacgacaccggcgaccgctccgactacctcaaggccaccgtccgcatcgcctgggagcgg
gaggacctgggcccggagttccgcacctggctgcgggagttcatggccgccgacgtcctc
gcacccgcccactga

DBGET integrated database retrieval system