KEGG   Kitasatospora setae: KSE_75940tHelp
Entry
KSE_75940t        CDS       T01648                                 

Definition
(GenBank) putative major facilitator superfamily transporter
  KO
K19577  
MFS transporter, DHA1 family, inner membrane transport protein
Organism
ksk  Kitasatospora setae
Brite
Transporters [BR:ksk02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    KSE_75940t
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
8689278..8690504
Genome map
AA seq 408 aa AA seqDB search
MPLALIALALGAFGIGTTEFVIVGLLPQIAGDFSVSIPSAGMLVTGYALGVVVGAPLMTA
AGSRLPRKTMLAVLMALFIAGNLLCAFAGSYTQLMTGRLVAALTHGAFFGIGSVVAAGLV
APARRASAIALMFTGLTVANVLGVPLGTFLGQHFGWRSTFWAVTAFGVVGLCGITALVPR
QERERGAGLRGELAVFRRPQVWLALLTTTLGFAGVFASFTYVAPMMTEVAGFPPGAVTWL
LVLFGAGLCVGNVLGGRAADRSLMPSLYVILAALAGVLLLFVATARTPVSAAITLAALGA
VGFATVPPLQMRVMQKAEGAPALASAANIAAFNLGNAVGAWLGGLTISHGLGYTAPNWVG
ALLAVAGLAVAALAGLLDRRTAADGPPPPHDPPPHDLPASEQTSPAAA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggccctcatcgccctggccctgggcgccttcggcatcgggacgacggaattc
gtcatcgtcggcctgctcccgcagatcgcgggggacttctcggtctccatcccctccgcc
gggatgctcgtcaccggctacgccctcggcgtggtcgtcggcgccccgctgatgaccgcc
gccggatcccggctgccgcgcaagaccatgctcgccgtcctgatggccctcttcatcgcc
ggcaacctgctctgcgccttcgcgggcagctacacccagctgatgaccggccggctggtc
gccgcgctcacccacggagcgttcttcggcatcgggtccgtcgtcgccgcgggcctggtc
gccccggcccgccgggccagcgcgatcgccctgatgttcaccggcctcaccgtcgccaac
gtcctcggcgtgccgctgggcaccttcctcggacagcacttcggctggcgctcgacgttc
tgggcggtcaccgccttcggcgtcgtcggcctctgcggcatcaccgccctcgtcccgcgc
caggagcgcgagcgcggcgccggcctgcgcggcgaactcgcggtcttccgccgcccccag
gtatggctggcgctgctgaccaccaccctcggcttcgccggggtcttcgcctccttcacc
tacgtcgcgccgatgatgaccgaggtcgccggattcccgcccggcgccgtgacctggctg
ctggtgctcttcggagcgggcctgtgcgtcggcaacgtcctgggcgggcgcgcggccgac
cgcagcctgatgcccagcctctacgtcatcctcgccgccctcgcgggcgtcctgctcctg
ttcgtcgccaccgcccgcacacccgtgtcggcggcgatcaccctcgcggcactgggagcc
gtcggcttcgccaccgtgccgccgctgcagatgcgggtcatgcagaaagccgagggggct
ccggccctcgcctcggcggccaacatcgcggcgttcaacctgggcaacgccgtcggggcc
tggctcggcggcctcaccatcagccacgggctcggctacaccgcccccaactgggtcggc
gccctgctggccgtcgccggcctcgccgtcgccgccctcgccggactgctcgaccgccgc
accgccgcggacggccccccgcccccgcacgacccgcccccgcacgacctgcccgcgagc
gagcagacctcgcccgcggcggcctga

DBGET integrated database retrieval system