KEGG   Kitasatospora setae: KSE_76000tHelp
Entry
KSE_76000t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
8696627..8697880
Genome map
AA seq 417 aa AA seqDB search
MTANDASHLRAPRFAAEIVADQLRDGYWLEAPDIDNDNKPDLFGYGLRLGEIYWYQNGEK
WTRRLVADKIKMPVGADFADISGNGHPDIIVCYDLYGPIGTIQDANTAGGKIDWLENPGS
PDKDESRWKRHYVGRATGMHRLRVGHFTQTERLEIIGLPIVAKEDVHAVLPVVLFTQPDD
VQSAEEWPMTVIDDSHFRMIHGAEKKPGLIPGSDRDSLLLASDEGVTWLYWDDSAKEWVR
KLIGTGELTQFEQTGFRGSGDLNAGRIGDDPMAYVAAIEPFHGNTVAVYTKTTDGPAGEA
EWKRTLLDVYGDPNENGEGPGHQIVCADFDGDGEDEFLVALRGPWPWQGVMYYKAIDLEN
GVWAKWRVSDESVARIATADFNGDGRLDFATIAYSVQHYYVAKDAKLMLYRNEIEQQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaacgacgcatcccacctgcgcgccccccgcttcgccgccgagatcgtggcc
gaccagctgcgcgacggctactggctggaggcccccgacatcgacaacgacaacaagccg
gacctgttcggctacggtctgcggctcggcgagatctactggtaccagaacggcgagaag
tggacccgccgcctggtcgccgacaagatcaagatgccggtcggcgcggacttcgccgac
atcagcggcaacggccaccccgacatcatcgtctgctacgacctctacggcccgatcggc
accatccaggacgccaacaccgccggcgggaagatcgactggctggagaaccccggcagc
ccggacaaggacgagtcccgctggaagcggcactacgtcggccgcgccaccggcatgcac
cgcctgcgcgtcggccacttcacccagaccgagcgcctggagatcatcggcctgccgatc
gtcgccaaggaggacgtccacgcggtcctgcccgtcgtcctgttcacccagcccgacgac
gtccagagcgccgaggaatggccgatgacggtcatcgacgacagccacttccgcatgatc
cacggcgccgagaagaagccgggcctcatccccggctccgaccgcgactccctgctcctg
gcctccgacgagggcgtcacctggctctactgggacgactccgccaaggaatgggtccgc
aagctcatcggcaccggcgaactcacccagttcgagcagaccggcttccgcggcagcggc
gacctcaacgccggccgcatcggcgacgacccgatggcctacgtcgccgcgatcgagccc
ttccacggcaacaccgtcgccgtctacaccaagaccaccgacggcccggccggcgaggcc
gagtggaagcgcaccctgctcgacgtctacggcgaccccaacgagaacggcgagggcccc
ggacaccagatcgtgtgcgccgacttcgacggcgacggcgaggacgagttcctggtcgcg
ctgcgcggaccgtggccgtggcagggcgtcatgtactacaaggcgatcgacctggagaac
ggcgtctgggccaagtggcgcgtctccgacgagtccgtcgcacgcatcgccaccgccgac
ttcaacggcgacggccgcctcgacttcgccaccatcgcctactcggtccagcactactac
gtggccaaggacgccaagctcatgctctaccgcaacgagatcgagcagcagtag

DBGET integrated database retrieval system